Rv0576 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: transcriptional regulator arsR-family
- REFSEQ: ArsR family transcriptional regulator
- PATRIC: Transcriptional regulator ArsR family
- TUBERCULIST: Probable transcriptional regulatory protein (possibly ArsR-family)
- NCBI: Probable transcriptional regulatory protein (possibly ArsR-family)
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 669848
End: 671152
Operon:

Trans-membrane region:
Role: I.J.1 - Repressors/activators
GO terms:
- GO:0006950 - response to stress (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0003700 - DNA binding transcription factor activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
3F6V	68%	Rhodococcus sp. RHA1	Crystal structure of Possible transcriptional regulator for arsenical resistance
1SMT	44%	Synechococcus elongatus	SMTB REPRESSOR FROM SYNECHOCOCCUS PCC7942
1R23	44%	Synechococcus elongatus PCC 7942	Crystal structure of the cyanobacterial metallothionein repressor SmtB in the Zn1-form (one Zn(II) per dimer)
1R22	44%	Synechococcus elongatus PCC 7942	Crystal structure of the cyanobacterial metallothionein repressor SmtB (C14S/C61S/C121S mutant) in the Zn2alpha5-form
1R1T	44%	Synechococcus elongatus PCC 7942	Crystal structure of the cyanobacterial metallothionein repressor SmtB in the apo-form
2LAK	40%	Rhizobium etli	Solution NMR structure of the AHSA1-like protein RHE_CH02687 (1-152) from Rhizobium etli, Northeast Structural Genomics Consortium Target ReR242
2P4W	37%	Pyrococcus furiosus	Crystal structure of heat shock regulator from Pyrococcus furiosus
3GW2	36%	Mycobacterium bovis	Crystal structure of possible transcriptional regulatory protein (fragment 1-100) from Mycobacterium bovis. Northeast Structural Genomics Consortium Target MbR242E.
2KKO	36%	Mycobacterium bovis	Solution NMR structure of the homodimeric winged helix-turn-helix DNA-binding domain (fragment 1-100) Mb0332 from Mycobacterium bovis, a possible ArsR-family transcriptional regulator. Northeast Structural Genomics Consortium Target MbR242E.

Links to additional information on Rv0576:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.133 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MLEVAAEPTRRRLLQLLAPGERTVTQLASQFTVTRSAISQHLGMLAEAGLVTARKQGRERYYRLDERGVLRLRALMESFWSDELDRLVADAAHYPPSQGD
CAMPFEKAVVVPLDPTSTFALITQPDRLRRWMAVAARIELRTGGAYRWTVTPGHSAAGTVIDVDPGKRVVFTWGWEDHGDPPPGGSTVTITLTPVDGGTE
VRLVHDGLTAQQAARHAKGWNHFLDRLVVAGQRGDAGPDEWAAAPDPLDELSCAEATLAVLQHVLRGIGASDLTRQTPCTEYDVSQLADHLLRSLAIIGA
AAGAQLAPRDVDAPLETQVADAAQAVMEAWRRRGLAGTVELNSNQVPATVPVGILCLEFLVHAWDFAIATGSQVIASEPVSEYVLAVAGKVITPATRNSA
GFAAPAAVGSFAPVLDRLIAFTGRQPTAGHVSAT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 19 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 19 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 19 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 20 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 20 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.31
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- Rv0114 (gmhB) (Direct binding)
- Rv0165c (mce1R) (Direct binding)
- Rv0166 (fadD5) (Direct binding)
- Rv0300 (vapB2) (Direct binding)
- Rv0302 (-) (Direct binding)
- Rv0412c (-) (Direct binding)
- Rv0413 (mutT3) (Direct binding)
- Rv0516c (-) (Direct binding)
- Rv0517 (-) (Direct binding)
- Rv0576 (-) (Direct binding)
- Rv0668 (rpoC) (Direct binding)
- Rv0768 (aldA) (Direct binding)
- Rv1519 (-) (Direct binding)
- Rv1847 (-) (Direct binding)
- Rv1876 (bfrA) (Direct binding)
- Rv1986 (-) (Direct binding)
- Rv2034 (-) (Direct binding)
- Rv2145c (wag31) (Direct binding)
- Rv2307B (-) (Direct binding)
- Rv2336 (-) (Direct binding)
- Rv2761c (hsdS) (Direct binding)
- Rv2779c (-) (Direct binding)
- Rv3219 (whiB1) (Direct binding)
- Rv3403c (-) (Direct binding)
- Rv3429 (PPE59) (Direct binding)
- Rv3499c (mce4A) (Direct binding)
- Rv3500c (yrbE4B) (Direct binding)
- Rv3528c (-) (Direct binding)
- Rv3583c (-) (Direct binding)
- Rv3660c (-) (Direct binding)
- Rv3661 (-) (Direct binding)
- Rv3681c (whiB4) (Direct binding)
- Rv0301 (vapC2) (Upstream of operon)
- Rv0303 (-) (Upstream of operon)
- Rv0410c (pknG) (Upstream of operon)
- Rv0411c (glnH) (Upstream of operon)
- Rv0577 (TB27.3) (Upstream of operon)
- Rv0769 (-) (Upstream of operon)
- Rv1520 (-) (Upstream of operon)
- Rv2035 (-) (Upstream of operon)
- Rv2036 (-) (Upstream of operon)
- Rv2778c (-) (Upstream of operon)
- Rv3581c (ispF) (Upstream of operon)
- Rv3582c (ispD) (Upstream of operon)
Bound By:
- Rv0081 (-) (Direct binding)
- Rv0576 (-) (Direct binding)
- Rv1404 (-) (Direct binding)
- Rv1816 (-) (Direct binding)
- Rv2034 (-) (Direct binding)
- Rv3597c (lsr2) (Direct binding)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulates Rv0577	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Andreu, CY. Soto et al. Mycobacterium smegmatis displays the Mycobacterium tuberculosis virulence-related neutral red character when expressing the Rv0577 gene. FEMS Microbiol. Lett. 2004
Citation	Mycobacterium smegmatis displays the Mycobacterium tuberculosis virulence-related neutral red character when expressing the Rv0577 gene. N. Andreu, CY. Soto et al. FEMS Microbiol. Lett. 2004	yamir.moreno	IEP	14987776	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0576	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Andreu, CY. Soto et al. Mycobacterium smegmatis displays the Mycobacterium tuberculosis virulence-related neutral red character when expressing the Rv0577 gene. FEMS Microbiol. Lett. 2004
Interaction	RegulatedBy Rv0576	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Andreu, CY. Soto et al. Mycobacterium smegmatis displays the Mycobacterium tuberculosis virulence-related neutral red character when expressing the Rv0577 gene. FEMS Microbiol. Lett. 2004
Citation	Mycobacterium smegmatis displays the Mycobacterium tuberculosis virulence-related neutral red character when expressing the Rv0577 gene. N. Andreu, CY. Soto et al. FEMS Microbiol. Lett. 2004	yamir.moreno	IEP	14987776	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..

TB Genome Annotation Portal

Rv0576 (-)

Amino Acid Sequence

Additional Information

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Interactions based on TFOE data (Rustad et al. 2014)

TBCAP

Comments