TB Genome Annotation Portal

Rv0553 (menC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: O-succinylbenzoate synthase
  • REFSEQ: O-succinylbenzoate synthase
  • PATRIC: O-succinylbenzoate synthase (EC 4.2.1.113)
  • TUBERCULIST: Probable muconate cycloisomerase MenC (ciscis-muconate lactonizing enzyme) (MLE)
  • NCBI: Probable muconate cycloisomerase MenC (cis,cis-muconate lactonizing enzyme) (MLE)
  • updated information (H37Rv4):
    • gene name: menC
    • function:
    • reference:
• Type: Not Target
• Start: 644490
• End: 645470
• Operon:


• Trans-membrane region:
  
• Role: I.G.11 - Menaquinone, PQQ, ubiquinone and other terpenoids
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016836 - hydro-lyase activity (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0009234 - menaquinone biosynthetic process (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + COA[c] + OSB[c] -> PPI[c] + AMP[c] + OSBCOA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2QVH	51%	Thermobifida fusca	Crystal structure of O-succinylbenzoate synthase complexed with O-succinyl benzoate (OSB)
  2OPJ	51%	Thermobifida fusca	Crystal structure of O-succinylbenzoate synthase
  3S5S	38%	Sorangium cellulosum	Crystal structure of putative mandelate racemase/muconate lactonizing enzyme (PSI/COM target 200551) from Sorangium cellulosum
  3KUM	37%	Enterococcus faecalis	Crystal structure of Dipeptide Epimerase from Enterococcus faecalis V583 complexed with Mg and dipeptide L-Arg-L-Tyr
  3K1G	37%	Enterococcus faecalis V583	Crystal structure of Dipeptide Epimerase from Enterococcus faecalis V583 complexed with Mg and dipeptide L-Ser-L-Tyr
  3JZU	37%	Enterococcus faecalis V583	Crystal structure of Dipeptide Epimerase from Enterococcus faecalis V583 complexed with Mg and dipeptide L-Leu-L-Tyr
  3JW7	37%	Enterococcus faecalis V583	Crystal structure of Dipeptide Epimerase from Enterococcus faecalis V583 complexed with Mg and dipeptide L-Ile-L-Tyr
  3JVA	37%	Enterococcus faecalis V583	Crystal structure of Dipeptide Epimerase from Enterococcus faecalis V583

• Links to additional information on menC:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -4.646 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC

Amino Acid Sequence

VIPVLPPLEALLDRLYVVALPMRVRFRGITTREVALIEGPAGWGEFGAFVEYQSAQACAWLASAIETAYCAPPPVRRDRVPINATVPAVAAAQVGEVLAR
FPGARTAKVKVAEPGQSLADDIERVNAVRELVPMVRVDANGGWGVAEAVAAAAALTADGPLEYLEQPCATVAELAELRRRVDVPIAADESIRKAEDPLAV
VRAQAADIAVLKVAPLGGISALLDIAARIAVPVVVSSALDSAVGIAAGLTAAAALPELDHACGLGTGGLFEEDVAEPAAPVDGFLAVARTTPDPARLQAL
GAPPQRRQWWIDRVKACYSLLVPSFG

Additional Information