TB Genome Annotation Portal

Rv0548c (menB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 14-Dihydroxy-2-naphthoyl-CoA synthase
  • REFSEQ: naphthoate synthase
  • PATRIC: Naphthoate synthase (EC 4.1.3.36)
  • TUBERCULIST: Naphthoate synthase MenB (dihydroxynaphthoic acid synthetase) (DHNA synthetase)
  • NCBI: Naphthoate synthase MenB (dihydroxynaphthoic acid synthetase) (DHNA synthetase)
  • updated information (H37Rv4):
    • gene name: menB
    • function:
    • reference:
• Type: Not Target
• Start: 639012
• End: 639956
• Operon:


• Trans-membrane region:
  
• Role: I.G.11 - Menaquinone, PQQ, ubiquinone and other terpenoids
• GO terms:
  • GO:0034214 - protein hexamerization (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0009234 - menaquinone biosynthetic process (Uniprot)
  • GO:0008935 - 1,4-dihydroxy-2-naphthoyl-CoA synthase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • OSBCOA[c] -> COA[c] + DHN[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 1q52, 3t8b, 3t8a, 1rjm, 1rjn, 1q52, 1q51
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4QIJ	99%	Mycobacterium tuberculosis H37Rv	Crystal structure of MenB from Mycobacteria tuberculosis in complex with 1-HNA-CoA
  4QII	99%	Mycobacterium tuberculosis H37Rv	Crystal Structure of type II MenB from Mycobacteria tuberculosis
  3T8B	99%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis MenB with altered hexameric assembly
  3T8A	99%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis MenB in complex with substrate analogue, OSB-NCoA
  1RJN	99%	Mycobacterium tuberculosis	The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
  1RJM	99%	Mycobacterium tuberculosis	Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis
  1Q52	99%	Mycobacterium tuberculosis	Crystal Structure of Mycobacterium tuberculosis MenB, a Key Enzyme in Vitamin K2 Biosynthesis
  1Q51	99%	Mycobacterium tuberculosis	Crystal Structure of Mycobacterium tuberculosis MenB in Complex with Acetoacetyl-Coenzyme A, a Key Enzyme in Vitamin K2 Biosynthesis
  6OJM	65%	Elizabethkingia anophelis NUHP1	Crystal structure of 1,4-dihydroxy-2-naphthoyl-CoA synthase Elizabethkingia anophelis NUHP1
  4I52	52%	Synechocystis sp.	scMenB im complex with 1-hydroxy-2-naphthoyl-CoA

• Links to additional information on menB:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -3.806 (from Jeremy Rock's lab)
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWA
FCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYL
ARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFL
QKRPPDWSPFPRYF

Additional Information