Rv0534c (menA)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: 14-dihydroxy-2-naphthoate octaprenyltransferase
- REFSEQ: 14-dihydroxy-2-naphthoate octaprenyltransferase
- PATRIC: 14-dihydroxy-2-naphthoate octaprenyltransferase (EC 2.5.1.74)
- TUBERCULIST: 14-dihydroxy-2-naphthoate octaprenyltransferase MenA (DHNA-octaprenyltransferase)
- NCBI: 1,4-dihydroxy-2-naphthoate octaprenyltransferase MenA (DHNA-octaprenyltransferase)
- updated information (H37Rv4):
  - gene name: menA
  - function:
  - reference:
Type: Not Target
Start: 625562
End: 626440
Operon:

Trans-membrane region:
Role: I.G.11 - Menaquinone, PQQ, ubiquinone and other terpenoids
GO terms:
- GO:0046428 - 1,4-dihydroxy-2-naphthoate octaprenyltransferase activity (Uniprot)
- GO:0042371 - vitamin K biosynthetic process (Uniprot)
- GO:0032194 - ubiquinone biosynthetic process via 3,4-dihydroxy-5-polyprenylbenzoate (Uniprot)
- GO:0016765 - transferase activity, transferring alkyl or aryl (other than methyl) groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0009234 - menaquinone biosynthetic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0004659 - prenyltransferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- DHN[c] + NPP[c] -> PPI[c] + CO2[c] + DMK[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on menA:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -5.845 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VASFAQWVSGARPRTLPNAIAPVVAGTGAAAWLHAAVWWKALLALAVAVALVIGVNYANDYSDGIRGTDDDRVGPVRLVGSRLATPRSVLTAAMTSLALG
ALAGLVLALLSAPWLIAVGAICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQALRVDWVGLAQAVATGALSCSVLVANNLRDIPTDARAD
KITLAVRLGDARTRMLYQGLLAVAGVLTFVLMLATPWCVVGLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALAVAGALAFGQLS

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.994900; 11 non-insertions in a row out of 11 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999650; 11 non-insertions in a row out of 11 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999900; 11 non-insertions in a row out of 11 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999450; 11 non-insertions in a row out of 12 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999550; 11 non-insertions in a row out of 12 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.43
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3286c (sigF)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv3286c (sigF)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Structure of naphthoate synthase (MenB) from Mycobacterium tuberculosis in both native and product-bound forms. JM. Johnston, VL. Arcus et al. Acta Crystallogr. D Biol. Crystallogr. 2005	njamshidi	ISS	16131752\|12909628	see PMID: 16131752, 12909628
Term	TBRXN:DHNAOT 1,4-dihydroxy-2-naphthoate octaprenyltransferase - ISS	njamshidi	ISS	16131752\|12909628	see PMID: 16131752, 12909628 JM. Johnston, VL. Arcus et al. Structure of naphthoate synthase (MenB) from Mycobacterium tuberculosis in both native and product-bound forms. Acta Crystallogr. D Biol. Crystallogr. 2005
Citation	Crystal structure of Mycobacterium tuberculosis MenB, a key enzyme in vitamin K2 biosynthesis. JJ. Truglio, K. Theis et al. J. Biol. Chem. 2003	njamshidi	ISS	16131752\|12909628	see PMID: 16131752, 12909628
Term	TBRXN:DHNAOT 1,4-dihydroxy-2-naphthoate octaprenyltransferase - ISS	njamshidi	ISS	16131752\|12909628	see PMID: 16131752, 12909628 JJ. Truglio, K. Theis et al. Crystal structure of Mycobacterium tuberculosis MenB, a key enzyme in vitamin K2 biosynthesis. J. Biol. Chem. 2003
Citation	Structure of naphthoate synthase (MenB) from Mycobacterium tuberculosis in both native and product-bound forms. JM. Johnston, VL. Arcus et al. Acta Crystallogr. D Biol. Crystallogr. 2005	njamshidi	IPI	16131752\|12909628	see PMID: 16131752, 12909628
Term	TBRXN:DHNAOT 1,4-dihydroxy-2-naphthoate octaprenyltransferase - IPI	njamshidi	IPI	16131752\|12909628	see PMID: 16131752, 12909628 JM. Johnston, VL. Arcus et al. Structure of naphthoate synthase (MenB) from Mycobacterium tuberculosis in both native and product-bound forms. Acta Crystallogr. D Biol. Crystallogr. 2005
Citation	Crystal structure of Mycobacterium tuberculosis MenB, a key enzyme in vitamin K2 biosynthesis. JJ. Truglio, K. Theis et al. J. Biol. Chem. 2003	njamshidi	IPI	16131752\|12909628	see PMID: 16131752, 12909628
Term	TBRXN:DHNAOT 1,4-dihydroxy-2-naphthoate octaprenyltransferase - IPI	njamshidi	IPI	16131752\|12909628	see PMID: 16131752, 12909628 JJ. Truglio, K. Theis et al. Crystal structure of Mycobacterium tuberculosis MenB, a key enzyme in vitamin K2 biosynthesis. J. Biol. Chem. 2003

TB Genome Annotation Portal