TB Genome Annotation Portal

Rv0516c (-)

Amino Acid Sequence

MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRGEIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQ
WALVASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA
(Nucleotide sequence available on KEGG)

Additional Information

Rv0516c - SigF anti-anti–sigma factor (renamed OprA)

phosphorylated by PknD

Greenstein et al (2007). M. tuberculosis Ser/Thr Protein Kinase D Phosphorylates an Anti-Anti–Sigma Factor Homolog. PLOS Pathogens.
https://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.0030049

Hatzios et al renamed Rv0516c as OprA, due to its involvement in an
osmosensory signaling pathway including PknD and SigF, which regulates
peptidoglycan architecture:

Hatzios, S. K. et al. (2013). Osmosensory signaling in Mycobacterium tuberculosis
mediated by a eukaryotic-like Ser/Thr protein kinase. PNAS 110, E5069-5077.
https://www.pnas.org/content/110/52/E5069

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 9 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 9 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 9 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 9 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 9 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 2.79
Growth-Advantage 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0516c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv3286chibeeluckIDACo-expression (Functional linkage)
    authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
    InteractionTranscription Rv3286chibeeluckIDACo-expression (Functional linkage)
    authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
    InteractionRegulatory Rv3286chibeeluckIDACo-expression (Functional linkage)
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    InteractionTranscription Rv3286chibeeluckIDACo-expression (Functional linkage)
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    InteractionRegulatory Rv3286chibeeluckIDACo-expression (Functional linkage)
    S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
    InteractionTranscription Rv3286chibeeluckIDACo-expression (Functional linkage)
    S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
    InteractionSignaling Rv0931cpriyadarshinipriyanka2001IDAspectrophotometric Analysis
    AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
    InteractionRegulatory Rv3287cyashabhasinIPIYeast two-hybrid (Physical interaction)
    AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
    CitationInteractions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. BK. Parida, T. Douglas et al. Tuberculosis (Edinburgh, Scotland) nullyashabhasinIPI16263329Yeast two-hybrid (Physical interaction)
    InteractionRegulatory Rv2638yashabhasinIPIYeast two-hybrid (Physical interaction)
    BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
    InteractionRegulatory Rv3687cyashabhasinIPIYeast two-hybrid (Physical interaction)
    BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
    InteractionRegulatory Rv3286cyashabhasinIPIYeast two-hybrid (Physical interaction)
    BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
    InteractionRegulatory Rv3287cyashabhasinIPIYeast two-hybrid (Physical interaction)
    BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
    CitationM. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. AE. Greenstein, JA. MacGurn et al. PLoS Pathog. 2007shahanup86IDA17411339Affinity purification (Physical interaction)
    InteractionRegulatory Rv0931cshahanup86IDAAffinity purification (Physical interaction)
    AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
    InteractionRegulatory Rv2638yashabhasinIPIYeast two-hybrid (Physical interaction)
    S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
    InteractionRegulatory Rv3687cyashabhasinIPIYeast two-hybrid (Physical interaction)
    S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
    InteractionRegulatory Rv3286cyashabhasinIPIYeast two-hybrid (Physical interaction)
    S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
    InteractionRegulatory Rv3287cyashabhasinIPIYeast two-hybrid (Physical interaction)
    S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
    CitationM. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. AE. Greenstein, JA. MacGurn et al. PLoS Pathog. 2007yashabhasinIPI17411339Yeast two-hybrid (Physical interaction)
    InteractionRegulatory Rv2638yashabhasinIPIYeast two-hybrid (Physical interaction)
    AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
    InteractionRegulatory Rv3687cyashabhasinIPIYeast two-hybrid (Physical interaction)
    AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
    InteractionRegulatory Rv3286cyashabhasinIPIYeast two-hybrid (Physical interaction)
    AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
    CitationStress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. S. Dhandayuthapani Front. Biosci. 2007yashabhasinIPI17485404Yeast two-hybrid (Physical interaction)
    InteractionRegulatedBy Rv3286cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003

    Comments