Rv0465c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: transcriptional regulator
- REFSEQ: transcriptional regulatory protein
- PATRIC: Transcriptional regulator XRE family
- TUBERCULIST: Probable transcriptional regulatory protein
- NCBI: Probable transcriptional regulatory protein
- updated information (H37Rv4):
  - gene name: ramB
  - function: regulates glyoxylate shunt
  - reference: Micklinghoff (2009) PMID: 19767422
Type: Not Target
Start: 554882
End: 556306
Operon:

Trans-membrane region:
Role: I.J.1 - Repressors/activators
GO terms:
- GO:0043565 - sequence-specific DNA binding (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
- GO:0001666 - response to hypoxia (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6D2S	51%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Mycobacterium tuberculosis transcriptional regulator
6CYJ	46%	Mycobacterium tuberculosis	Mycobacterium tuberculosis transcriptional regulator
6CYY	46%	Mycobacterium tuberculosis	Mycobacterium tuberculosis transcriptional regulator
6CZ6	45%	Mycobacterium tuberculosis	Mycobacterium tuberculosis transcriptional regulator

Links to additional information on Rv0465c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.105 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VSKTYVGSRVRQLRNERGFSQAALAQMLEISPSYLNQIEHDVRPLTVAVLLRITEVFGVDATFFASQDDTRLVAELREVTLDRDLDIAIDPHEVAEMVSA
HPGLACAVVNLHRRYRITTAQLAAATEERFSDGSGRGSITMPHEEVRDYFYQRQNYLHALDTAAEDLTAQMRMHHGDLARELTRRLTEVHGVRINKRIDL
GDTVLHRYDPATNTLEISSHLSPGQQVFKMAAELAYLEFGDLIDAMVTDGKFTSAESRTLARLGLANYFAAATVLPYRQFHDVAENFRYDVERLSAFYSV
SYETIAHRLSTLQRPSMRGVPFTFVRVDRAGNMSKRQSATGFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYLWVARTVELRAARYGQPGKTF
AIGLGCELRHAHRLVYSEGLDLSGDPNTAATPIGAGCRVCERDNCPQRAFPALGRALDLDEHRSTVSPYLVKQL

(Nucleotide sequence available on KEGG)

Additional Information

RamB, regulates expression of ICL (Micklinghoff, 2009, PMC2786550)

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 28 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 28 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 28 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 28 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 28 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- Rv0404 (fadD30) (Direct binding)
- Rv0456A (mazF1) (Direct binding)
- Rv0464c (-) (Direct binding)
- Rv0465c (-) (Direct binding)
- Rv0466 (-) (Direct binding)
- Rv0467 (icl1) (Direct binding)
- Rv0472c (-) (Direct binding)
- Rv0473 (-) (Direct binding)
- Rv0928 (pstS3) (Direct binding)
- Rv0929 (pstC2) (Direct binding)
- Rv1089A (celA2a) (Direct binding)
- Rv1129c (-) (Direct binding)
- Rv1130 (prpD) (Direct binding)
- Rv1161 (narG) (Direct binding)
- Rv1302 (rfe) (Direct binding)
- Rv1356c (-) (Direct binding)
- Rv1374c (-) (Direct binding)
- Rv1500 (-) (Direct binding)
- Rv1501 (-) (Direct binding)
- Rv1503c (-) (Direct binding)
- Rv1791 (PE19) (Direct binding)
- Rv1847 (-) (Direct binding)
- Rv1926c (mpt63) (Direct binding)
- Rv2145c (wag31) (Direct binding)
- Rv2307B (-) (Direct binding)
- Rv2336 (-) (Direct binding)
- Rv2452c (-) (Direct binding)
- Rv2478c (-) (Direct binding)
- Rv2479c (-) (Direct binding)
- Rv2516c (-) (Direct binding)
- Rv2517c (-) (Direct binding)
- Rv2544 (lppB) (Direct binding)
- Rv2545 (vapB18) (Direct binding)
- Rv2909c (rpsP) (Direct binding)
- Rv3060c (-) (Direct binding)
- Rv3068c (pgmA) (Direct binding)
- Rv3138 (pflA) (Direct binding)
- Rv3139 (fadE24) (Direct binding)
- Rv3144c (PPE52) (Direct binding)
- Rv3191c (-) (Direct binding)
- Rv3269 (-) (Direct binding)
- Rv3323c (moaX) (Direct binding)
- Rv3370c (dnaE2) (Direct binding)
- Rv3371 (-) (Direct binding)
- Rv3376 (-) (Direct binding)
- Rv3378c (-) (Direct binding)
- Rv3724A (cut5a) (Direct binding)
- Rv3724B (cut5b) (Direct binding)
- Rv0405 (pks6) (Upstream of operon)
- Rv0471c (-) (Upstream of operon)
- Rv0930 (pstA1) (Upstream of operon)
- Rv1090 (celA2b) (Upstream of operon)
- Rv1131 (prpC) (Upstream of operon)
- Rv1132 (-) (Upstream of operon)
- Rv1162 (narH) (Upstream of operon)
- Rv1353c (-) (Upstream of operon)
- Rv1354c (-) (Upstream of operon)
- Rv1355c (moeY) (Upstream of operon)
- Rv2906c (trmD) (Upstream of operon)
- Rv2907c (rimM) (Upstream of operon)
- Rv2908c (-) (Upstream of operon)
- Rv3140 (fadE23) (Upstream of operon)
- Rv3270 (ctpC) (Upstream of operon)
Bound By:
- Rv0465c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Rv0465c (-)
- Rv0467 (icl1)
Upregulated by:
Downregulates:
Downregulated by:

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv0465c (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv0464c	sourish10	IPI		Affinity purification (Physical interaction) JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Regulatory Rv0464c	sourish10	IDA		Affinity purification (Physical interaction) JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	priyadarshinipriyanka2001	IDA	19767422	Band shift
Interaction	Regulatory Rv0467	priyadarshinipriyanka2001	IDA		Band shift JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IEP	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0464c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IDA	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0464c	yamir.moreno	IDA		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IDA	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0467	yamir.moreno	IDA		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IEP	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0464c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0465c	yamir.moreno	IDA		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IEP	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0467	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IEP	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0467	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0465c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IEP	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0465c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0465c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IDA	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0465c	yamir.moreno	IDA		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Citation	Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009	yamir.moreno	IEP	19767422	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0465c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv0464c

sourish10

IPI

Affinity purification (Physical interaction)
JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009

Interaction

Regulatory Rv0464c

sourish10

IDA

Citation

Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange J. Bacteriol. 2009

priyadarshinipriyanka2001

IDA

19767422

Band shift

Interaction

Regulatory Rv0467

priyadarshinipriyanka2001

IDA

Band shift
JC. Micklinghoff,KJ. Breitinger,M. Schmidt,R. Geffers,BJ. Eikmanns,FC. Bange Role of the transcriptional regulator RamB (Rv0465c) in the control of the glyoxylate cycle in Mycobacterium tuberculosis. J. Bacteriol. 2009

Citation

yamir.moreno

IEP

19767422

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv0464c

yamir.moreno

IEP

Citation

yamir.moreno

IDA

19767422

Interaction

Regulates Rv0464c

yamir.moreno

IDA

Citation

yamir.moreno

IDA

19767422

Interaction

Regulates Rv0467

yamir.moreno

IDA

Citation

yamir.moreno

IEP

19767422

Interaction

Regulates Rv0464c

yamir.moreno

IEP

Interaction

RegulatedBy Rv0465c

yamir.moreno

IDA

Citation

yamir.moreno

IEP

19767422

Interaction

Regulates Rv0467

yamir.moreno

IEP

Citation

yamir.moreno

IEP

19767422

Interaction

Regulates Rv0467

yamir.moreno

IEP

Interaction

RegulatedBy Rv0465c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

19767422

Interaction

Regulates Rv0465c

yamir.moreno

IEP

Interaction

RegulatedBy Rv0465c

yamir.moreno

IEP

Citation

yamir.moreno

IDA

19767422

Interaction

Regulates Rv0465c

yamir.moreno

IDA

Citation

yamir.moreno

IEP

19767422

Interaction

Regulates Rv0465c

yamir.moreno

IEP

Interaction

RegulatedBy Rv0981

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006

Comments