Rv0436c (pssA)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: CDP-diacylglycerol-serine O-phosphatidyltransferase
- REFSEQ: CDP-diacylglycerol--serine O-phosphatidyltransferase
- PATRIC: CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)
- TUBERCULIST: Probable CDP-diacylglycerol--serine O-phosphatidyltransferase PssA (PS synthase) (phosphatidylserine synthase)
- NCBI: Probable CDP-diacylglycerol--serine O-phosphatidyltransferase PssA (PS synthase) (phosphatidylserine synthase)
- updated information (H37Rv4):
  - gene name: pssA
  - function:
  - reference:
Type: Not Target
Start: 524530
End: 525390
Operon:

Trans-membrane region:
Role: I.H.3 - Acyltransferases, Mycoloyltransferases, and phospholipid synthesis
GO terms:
- GO:0046474 - glycerophospholipid biosynthetic process (Uniprot)
- GO:0016780 - phosphotransferase activity, for other substituted phosphate groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0008654 - phospholipid biosynthetic process (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
- GO:0003882 - CDP-diacylglycerol-serine O-phosphatidyltransferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- SER[c] + CDPDG[c] <=> CMP[c] + PS[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on pssA:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -1.857 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMALIAAAAILDGLDGRVARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWP
VGWVVVLLYAVCVVLRLARYNALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGWWTSGWFLSFWVTGTSILLVSGIPMKKMHAVSVPPNYA
AALLAVLAICAAAAVLAPYLLIWVIIIAYMCHIPFAVRSQRWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRKPGRRL

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999950; 17 non-insertions in a row out of 17 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999950; 14 non-insertions in a row out of 17 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.008150; 7 non-insertions in a row out of 17 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.775050; 8 non-insertions in a row out of 17 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.234500; 7 non-insertions in a row out of 17 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0967 (csoR) (Direct binding)
- Rv1353c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Aust J Exp Biol Med Sci 1982	njamshidi	ISS	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?).
Term	EC:2.7.8.8 CDP-diacylglycerol--serine O-phosphatidyltransferase. - ISS	njamshidi	ISS	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	TBRXN:PSSA160 Phosphatidylserine syntase (n-C16:0) - ISS	njamshidi	ISS	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Citation	Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Aust J Exp Biol Med Sci 1982	njamshidi	ISS	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?).
Term	EC:2.7.8.8 CDP-diacylglycerol--serine O-phosphatidyltransferase. - ISS	njamshidi	ISS	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	TBRXN:PSSA180 Phosphatidylserine syntase (n-C18:0) - ISS	njamshidi	ISS	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Citation	Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Aust J Exp Biol Med Sci 1982	njamshidi	IPI	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?).
Term	EC:2.7.8.8 CDP-diacylglycerol--serine O-phosphatidyltransferase. - IPI	njamshidi	IPI	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Term	TBRXN:PSSA180 Phosphatidylserine syntase (n-C18:0) - IPI	njamshidi	IPI	6819845	Added for PE metabolism - these phospholipids (i.e. phosphatidylethanolamine) are known to be in Mtb (see for example: PMID: 6819845), however the details of the pathways have not been identified yet (for example do the phospholipase reactions take place in the intra-cellular space, within the cell wall, or extracellular?). authors,GK. Khuller,R. Taneja,S. Kaur,JN. Verma Lipid composition and virulence of Mycobacterium tuberculosis H37Rv. Aust J Exp Biol Med Sci 1982
Name	Putative phosphatidylserine synthase	mjackson	ISS		Phospholipid biosynthesis
Citation	Phosphatidylinositol is an essential phospholipid of mycobacteria. M. Jackson,DC. Crick,PJ. Brennan J. Biol. Chem. 2000	mjackson		10889206	Putative phosphatidylserine synthase
Term	TBPWY:Phospholipid-Biosynthesis Phospholipid Biosynthesis - NR	mjackson	NR		Putative phosphatidylserine synthase M. Jackson,DC. Crick,PJ. Brennan Phosphatidylinositol is an essential phospholipid of mycobacteria. J. Biol. Chem. 2000

TB Genome Annotation Portal