TB Genome Annotation Portal

Rv0436c (pssA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: CDP-diacylglycerol-serine O-phosphatidyltransferase
  • REFSEQ: CDP-diacylglycerol--serine O-phosphatidyltransferase
  • PATRIC: CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)
  • TUBERCULIST: Probable CDP-diacylglycerol--serine O-phosphatidyltransferase PssA (PS synthase) (phosphatidylserine synthase)
  • NCBI: Probable CDP-diacylglycerol--serine O-phosphatidyltransferase PssA (PS synthase) (phosphatidylserine synthase)
  • updated information (H37Rv4):
    • gene name: pssA
    • function:
    • reference:
• Coordinates in H37Rv: 524530 - 525390
• Gene length: 861 bp (with stop codon), 286 aa (without stop codon)
• Operon:


• Trans-membrane region:
  
• Role: I.H.3 - Acyltransferases, Mycoloyltransferases, and phospholipid synthesis
• GO terms:
  • GO:0046474 - glycerophospholipid biosynthetic process (Uniprot)
  • GO:0016780 - phosphotransferase activity, for other substituted phosphate groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0008654 - phospholipid biosynthetic process (Uniprot)
  • GO:0006629 - lipid metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0003882 - CDP-diacylglycerol-serine O-phosphatidyltransferase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • SER[c] + CDPDG[c] <=> CMP[c] + PS[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Latest Homologs in PDB
• Top 10 Homologs in PDB (as of Apr 2026):
  

  PDB	aa ident	species	PDB title
  7POW	36%	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)	Crystal structure of phosphatidyl serine synthase (PSS) in transition state.
  7B1N	36%	Methanocaldococcus jannaschii DSM 2661	Crystal structure of phosphatidyl serine synthase (PSS) in the closed conformation with bound citrate.
  7B1L	36%	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)	Crystal structure of phosphatidyl serine synthase (PSS) in the closed conformation with bound citrate.
  7B1K	36%	Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)	Crystal structure of phosphatidyl serine synthase (PSS) in the closed conformation with bound citrate.

• Links to additional information on pssA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -1.857 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMALIAAAAILDGLDGRVARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWP
VGWVVVLLYAVCVVLRLARYNALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGWWTSGWFLSFWVTGTSILLVSGIPMKKMHAVSVPPNYA
AALLAVLAICAAAAVLAPYLLIWVIIIAYMCHIPFAVRSQRWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRKPGRRL

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• data from Culviner et al (2025) (55,259 Mtb clinical isolates)
  • overall pN/pS for Rv0436c: 0.417656184
  • lineage-specific pN/pS in L1: 0.306051088
  • lineage-specific pN/pS in L2: 0.386590848
  • lineage-specific pN/pS in L3: 0.386590848
  • lineage-specific pN/pS in L4: 0.501745569

• Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
• clinical isolates collection: global set of 10,626 Mtb genomes
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	global set of 10,626 Mtb clinical isolates
under significant positive selection?	NO
omega peak height (95%CI lower bound)	1.18 (0.37)
codons under selection
omega plots
genetic variants*	link