Rv0375c (-)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: carbon-monoxide dehydrogenase medium subunit
REFSEQ: carbon monoxyde dehydrogenase medium subunit
PATRIC: Carbon monoxide dehydrogenase medium chain (EC 1.2.99.2)
TUBERCULIST: Probable carbon monoxyde dehydrogenase (medium chain)
NCBI: Probable carbon monoxyde dehydrogenase (medium chain)
updated information (H37Rv4):
gene name: -
function:
reference:
Coordinates in H37Rv: 452294 - 453154
Gene length: 861 bp (with stop codon), 286 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.B.7 - Miscellaneous oxidoreductases and oxygenases
GO terms:
GO:0055114 - oxidation-reduction process (Uniprot)
GO:0050660 - flavin adenine dinucleotide binding (Uniprot)
GO:0016614 - oxidoreductase activity, acting on CH-OH group of donors (Uniprot)
GO:0016491 - oxidoreductase activity (Uniprot)
GO:0003824 - catalytic activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 8UEM 80% Mycolicibacterium smegmatis MC2 155 The CryoEM structure of the high affinity Carbon monoxide dehydrogenase from Mycobacterium smegmatis 1FFV 39% Hydrogenophaga pseudoflava CARBON MONOXIDE DEHYDROGENASE FROM HYDROGENOPHAGA PSEUDOFLAVA 1FFU 39% Hydrogenophaga pseudoflava CARBON MONOXIDE DEHYDROGENASE FROM HYDROGENOPHAGA PSEUDOFLAVA WHICH LACKS THE MO-PYRANOPTERIN MOIETY OF THE MOLYBDENUM COFACTOR 1ZXI 37% Oligotropha carboxidovorans Reconstituted CO dehydrogenase from Oligotropha carboxidovorans 1N63 37% Oligotropha carboxidovorans Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state 1N62 37% Oligotropha carboxidovorans Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state 1N61 37% Oligotropha carboxidovorans Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Dithionite reduced state 1N60 37% Oligotropha carboxidovorans Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form 1N5W 37% Oligotropha carboxidovorans Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form
Links to additional information on Rv0375c:
Amino Acid Sequence
VDHAIGLLDRLGEGARVVAGGHSLLPMMKLRIANPEYLVDINDLAPELGYVVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAERVIADPVVRN
RGTLGGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPYETALAHNEVLIEVRIPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTI
LAARVGLTAVNPDPVALAELSAGLVGQPATEEVFAEAGRRAAQACTPVTDVRGTAEYKRHLAGELTVRTLRTAAGRVLGAPAAPEA
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0375c/-,
gene len: 860 bp, num TA sites: 8
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=0.4) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.569) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=1.0) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0375c: 0.710946573
lineage-specific pN/pS in L1: 0.516845974
lineage-specific pN/pS in L2: 0.691661524
lineage-specific pN/pS in L3: 0.664900811
lineage-specific pN/pS in L4: 0.848809546
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.25 (0.6)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation Growth of mycobacteria on carbon monoxide and methanol. authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim J. Bacteriol. 2003 njamshidi ISS 14660375|12486050 See PMID: 12486050, 14660375
Term TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - ISS njamshidi ISS 14660375|12486050 See PMID: 12486050, 14660375authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim Growth of mycobacteria on carbon monoxide and methanol. J. Bacteriol. 2003
Citation Uptake of carbon monoxide and hydrogen at environmentally relevant concentrations by mycobacteria. authors,GM. King Appl. Environ. Microbiol. 2003 njamshidi ISS 12486050|14660375 See PMID: 12486050, 14660375
Term TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - ISS njamshidi ISS 14660375|12486050 See PMID: 12486050, 14660375authors,GM. King Uptake of carbon monoxide and hydrogen at environmentally relevant concentrations by mycobacteria. Appl. Environ. Microbiol. 2003
Citation Growth of mycobacteria on carbon monoxide and methanol. authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim J. Bacteriol. 2003 njamshidi IPI 14660375|12486050 See PMID: 12486050, 14660375
Term TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - IPI njamshidi IPI 14660375|12486050 See PMID: 12486050, 14660375authors,SW. Park,EH. Hwang,H. Park,JA. Kim,J. Heo,KH. Lee,T. Song,E. Kim,YT. Ro,SW. Kim,YM. Kim Growth of mycobacteria on carbon monoxide and methanol. J. Bacteriol. 2003
Citation Uptake of carbon monoxide and hydrogen at environmentally relevant concentrations by mycobacteria. authors,GM. King Appl. Environ. Microbiol. 2003 njamshidi IPI 12486050|14660375 See PMID: 12486050, 14660375
Term TBRXN:CODH3 carbon monoxide dehydrogenase / acetyl-CoA synthase 2 - IPI njamshidi IPI 14660375|12486050 See PMID: 12486050, 14660375authors,GM. King Uptake of carbon monoxide and hydrogen at environmentally relevant concentrations by mycobacteria. Appl. Environ. Microbiol. 2003
Interaction Regulatory Rv2027c akankshajain.21 IEP Co-expression (Functional linkage)A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Citation Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn J. Biol. Chem. 2008 prabhakarsmail IEP 18400743 Co-expression (Functional linkage)
Interaction Regulatory Rv3132c prabhakarsmail IEP Co-expression (Functional linkage)A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction Regulatory Rv2027c prabhakarsmail IEP Co-expression (Functional linkage)A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Citation Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn J. Biol. Chem. 2008 akankshajain.21 IEP 18400743 Co-expression (Functional linkage)
Interaction Regulatory Rv3132c akankshajain.21 IEP Co-expression (Functional linkage)A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008