TB Genome Annotation Portal

Rv0350 (dnaK)

Amino Acid Sequence

MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLVGQPAKNQAVTNVDRTVRSVKRHMGSDWSIEIDGKKYTAPEISARILMKLK
RDAEAYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKGEKEQRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG
GDDWDQRVVDWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRITQDLLDRTRKPFQSVIADT
GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSETF
TTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEED
RKRREEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDISAIKSAMEKLGQESQALGQAIYEAAQAASQATGAAHPGGE
PGGAHPGSADDVVDAEVVDDGREAK
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0350/dnaK, gene len: 1877 bp, num TA sites: 17
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.017)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.0)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.97 (0.65)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv0350/dnaKRv0023/--1.18
    Rv0350/dnaKRv0260c/nnaR-1.25
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0350 (dnaK)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv0353dimpi.srcpIDABand Shift
    T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
    InteractionRegulatory Rv0353dimpi.srcpIDABand Shift
    authors,I. Smith Mycobacterium tuberculosis pathogenesis and molecular determinants of virulence. Clin. Microbiol. Rev. 2003
    CitationModulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. T. Das Gupta, B. Bandyopadhyay et al. Microbiology (Reading, Engl.) 2008shahanup86IDA18227252Co occurance (Functional Linkage)
    InteractionSignaling Rv0353shahanup86IDACo occurance (Functional Linkage)
    T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
    CitationComplementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Arch. Microbiol. 2004shahanup86IDA15448982Co occurance (Functional Linkage)
    InteractionSignaling Rv0353shahanup86IDACo occurance (Functional Linkage)
    authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Complementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. Arch. Microbiol. 2004
    InteractionRegulatory Rv0351ilamathi.rajaIDABand Shift
    T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
    InteractionRegulatory Rv0352dimpi.srcpIEPCo-expression (Functional linkage)
    GR. Stewart, BD. Robertson et al. Analysis of the function of mycobacterial DnaJ proteins by overexpression and microarray profiling. Tuberculosis (Edinburgh, Scotland) 2004
    CitationMycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. TB. Hickey, LM. Thorson et al. Infect. Immun. 2009shahanup86IDA19470749Gene Neighborhood (Functional Linkage)
    InteractionSignaling Rv0353shahanup86IDAGene Neighborhood (Functional Linkage)
    TB. Hickey, LM. Thorson et al. Mycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. Infect. Immun. 2009
    CitationModulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. T. Das Gupta, B. Bandyopadhyay et al. Microbiology (Reading, Engl.) 2008shahanup86IDA18227252Gene Neighborhood (Functional Linkage)
    InteractionSignaling Rv0353shahanup86IDAGene Neighborhood (Functional Linkage)
    T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
    CitationComplementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Arch. Microbiol. 2004shahanup86IDA15448982Gene Neighborhood (Functional Linkage)
    InteractionSignaling Rv0353shahanup86IDAGene Neighborhood (Functional Linkage)
    authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Complementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. Arch. Microbiol. 2004
    CitationMycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. TB. Hickey, LM. Thorson et al. Infect. Immun. 2009shahanup86IDA19470749Co occurance (Functional Linkage)
    InteractionSignaling Rv0353shahanup86IDACo occurance (Functional Linkage)
    TB. Hickey, LM. Thorson et al. Mycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. Infect. Immun. 2009
    InteractionRegulatory Rv0182cpriti.prietyIEPCo-expression (Functional linkage)
    JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
    InteractionRegulatedBy Rv3416yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3133cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2034yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv1221yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0981yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0491yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3223cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv0353yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

    Comments