TB Genome Annotation Portal

Rv0301 (vapC2)

Amino Acid Sequence

VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDL
LIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 7 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 7 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 7 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 8 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 8 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 1.87
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0301 (vapC2)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv0300sourish10IEPCo-expression (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    CitationProkaryotic toxin-antitoxin stress response loci. authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Nat. Rev. Microbiol. 2005sourish10IEP15864262Co-expression (Functional linkage)
    InteractionRegulatory Rv0300sourish10IEPCo-expression (Functional linkage)
    authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
    InteractionRegulatory Rv0300sourish10IEPCo-expression (Functional linkage)
    authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009ahal4789IEP20011113Co-expression (Functional linkage)
    InteractionRegulatory Rv0300ahal4789IEPCo-expression (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    CitationThe PIN-domain toxin-antitoxin array in mycobacteria. authors,VL. Arcus,PB. Rainey,SJ. Turner Trends Microbiol. 2005ahal4789IEP15993073Co-expression (Functional linkage)
    InteractionRegulatory Rv0300ahal4789IEPCo-expression (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    CitationProkaryotic toxin-antitoxin stress response loci. authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Nat. Rev. Microbiol. 2005ahal4789IEP15864262Co-expression (Functional linkage)
    InteractionRegulatory Rv0300ahal4789IEPCo-expression (Functional linkage)
    authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009sourish10IEP20011113Co-expression (Functional linkage)
    InteractionRegulatory Rv0300sourish10IEPCo-expression (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    CitationThe PIN-domain toxin-antitoxin array in mycobacteria. authors,VL. Arcus,PB. Rainey,SJ. Turner Trends Microbiol. 2005sourish10IEP15993073Co-expression (Functional linkage)
    InteractionRegulatory Rv0300ahal4789IEPCo-expression (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    InteractionRegulatory Rv0300ahal4789IEPCo-expression (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    InteractionRegulatory Rv0300ahal4789IEPCo-expression (Functional linkage)
    authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
    InteractionRegulatory Rv0300sourish10IEPCo-expression (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    InteractionRegulatory Rv0300sourish10IEPCo-expression (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009jlew20011113VapC homolog, PIN domain, Toxic when expressed in Msmeg, rescued by antitoxin (Rv0300)
    SymbolVapC2jlewWe report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationKilling activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009jlew19016878We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    Otherstart:364044rslaydenPredicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to other hypothetical Mycobacterium tuberculosis proteins e.g. Rv2757c, Rv0229c, Rv2546, etc.
    Otherstop:364469rslaydenPredicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to other hypothetical Mycobacterium tuberculosis proteins e.g. Rv2757c, Rv0229c, Rv2546, etc.
    Otherstrand:+rslaydenPredicted nucleic acid-binding protein, contains PIN domain. Conserved hypothetical protein, similar to other hypothetical Mycobacterium tuberculosis proteins e.g. Rv2757c, Rv0229c, Rv2546, etc.

    Comments