Rv0236c (aftD)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: transmembrane protein
- PATRIC: PROBABLE CONSERVED TRANSMEMBRANE PROTEIN
- TUBERCULIST: Possible arabinofuranosyltransferase AftD
- NCBI: Possible arabinofuranosyltransferase AftD
- updated information (H37Rv4):
  - gene name: aftD
  - function:
  - reference:
Type: Essential
Start: 282649
End: 286851
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:0045227 - capsule polysaccharide biosynthetic process (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6W98	62%	Mycobacteroides abscessus subsp. abscessus	Single-Particle Cryo-EM Structure of Arabinofuranosyltransferase AftD from Mycobacteria
6WBY	62%	Mycobacteroides abscessus	Single-Particle Cryo-EM Structure of Arabinofuranosyltransferase AftD from Mycobacteria, Mutant R1389S Class 2
6WBX	62%	Mycobacteroides abscessus	Single-Particle Cryo-EM Structure of Arabinofuranosyltransferase AftD from Mycobacteria, Mutant R1389S Class 1

Links to additional information on aftD:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -6.08 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VAPLSRKWLPVVGAVALALTFAQSPGQVSPDTKLDLTANPLRFLARATNLWNSDLPFGQAQNQAYGYLFPHGTFFVIGHLLGVPGWVTQRLWWAVLLTVG
FWGLLRVAEALGVGGPSSRVVGAVAFALSPRVLTTLGSISSETLPMMLAPWVLLPTILALRGTSGRSVRALAAQAGLAVALMGAVNAIATLAGCLPAVIW
WACHRPNRLWWRYTAWWLLAMALATLWWVMALTQLHGVSPPFLDFIESSGVTTQWSSLVEVLRGTDSWTPFVAPNATAGAPLVTGSAAILGTCLVAAAGL
AGLTSPAMPARGRLVTMLLVGVVLLAVGHRGGLASPVAHPVQAFLDAAGTPLRNVHKVGPVIRLPLVLGLAQLLSRVPLPGSAPRPAWLRAFAHPERDKR
VAVAVVALTALMVSTSLAWTGRVAPPGTFGALPQYWQEAADWLRTHHAATPTPGRVLVVPGAPFATQVWGTSHDEPLQVLGDGPWGVRDSIPLTPPQTIR
ALDSVQRLFAAGRPSAGLADTLARQGISYVLVRNDLDPETSRSARPILLHRSIAGSPGLAKLAEFGAPVGPDPLAGFVNDSGLRPRYPAIEIYRVSAPAN
PGAPYFAATDQLARVDGGPEVLLRLDERRRLQGQPPLGPVLMTADARAAGLPVPQVAVTDTPVARETDYGRVDHHSSAIRAPGDARHTYNRVPDYPVPGA
EPVVGGWTGGRITVSSSSADATAMPDVAPASAPAAAVDGDPATAWVSNALQAAVGQWLQVDFDRPVTNAVVTLTPSATAVGAQVRRILIETVNGSTTLRF
DEAGKPLTAALPYGETPWVRFTAAATDDGSAGVQFGITDLAITQYDASGFAHPVQLRHTVLVPGPPPGSAIAGWDLGSELLGRPGCAPGPDGVRCAASMA
LAPEEPANLSRTLTVPRPVSVTPMVWVRPRQGPKLADLIAAPSTTRASGDSDLVDILGSAYAAADGDPATAWTAPQRVVQHKTPPTLTLTLPRPTVVTGL
RLAASRSMLPAHPTVVAINLGDGPQVRQLQVGELTTLWLHPRVTDTVSVSLLDWDDVIDRNALGFDQLKPPGLAEVVVLSAGGAPIAPADAARNRARALT
VDCDHGPVVAVAGRFVHTSIRTTVGALLDGEPVAALPCEREPIALPAGQQELLISPGAAFVVDGAQLSTPGAGLSSATVTSAETGAWGPTHREVRVPESA
TSRVLVVPESINSGWVARTSTGARLTPIAVNGWQQAWVVPAGNPGTITLTFAPNSLYRASLAIGLALLPLLALLAFWRTGRRQLADRPTPPWRPGAWAAA
GVLAAGAVIASIAGVMVMGTALGVRYALRRRERLRDRVTVGLAAGGLILAGAALSRHPWRSVDGYAGNWASVQLLALISVSVVAASVVATSESRGQDRMQ

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 39 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 39 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 39 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 40 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 40 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.04
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1353c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)

Property	Value	Creator	Evidence	PMID	Comment
Name	Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM	mjackson	IMP		PIM, LM and LAM biosynthesis
Symbol	aftD	mjackson	IDA		PIM, LM and LAM biosynthesis
Name	Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM	mjackson	IDA		PIM, LM and LAM biosynthesis
Symbol	aftD	mjackson	IMP		PIM, LM and LAM biosynthesis
Symbol	aftD	mjackson	IMP		Arabinosyltransferases
Name	Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM	mjackson	IMP		Arabinosyltransferases
Symbol	aftD	mjackson	IDA		Arabinosyltransferases
Name	Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM	mjackson	IDA		Arabinosyltransferases
Symbol	aftD	mmcneil			Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic) H. Skovierov, G. Larrouy-Maumus et al. AftD, a novel essential arabinofuranosyltransferase from mycobacteria. Glycobiology 2009
Citation	AftD, a novel essential arabinofuranosyltransferase from mycobacteria. H. Skovierov, G. Larrouy-Maumus et al. Glycobiology 2009	mmcneil		19654261	Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
Term	GO:0052636 arabinosyltransferase activity - NR	mmcneil	NR		Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic) H. Skovierov, G. Larrouy-Maumus et al. AftD, a novel essential arabinofuranosyltransferase from mycobacteria. Glycobiology 2009
Symbol	aftD	mjackson			Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic) H. Skovierov, G. Larrouy-Maumus et al. AftD, a novel essential arabinofuranosyltransferase from mycobacteria. Glycobiology 2009
Citation	AftD, a novel essential arabinofuranosyltransferase from mycobacteria. H. Skovierov, G. Larrouy-Maumus et al. Glycobiology 2009	mjackson		19654261	Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:PIM, LM and LAM biosynthesis	mjackson			Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase likely to participate in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic) H. Skovierov, G. Larrouy-Maumus et al. AftD, a novel essential arabinofuranosyltransferase from mycobacteria. Glycobiology 2009

TB Genome Annotation Portal