TB Genome Annotation Portal

Rv0211 (pckA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: phosphoenolpyruvate carboxykinase [GTP]
  • REFSEQ: phosphoenolpyruvate carboxykinase
  • PATRIC: Phosphoenolpyruvate carboxykinase [GTP] (EC 4.1.1.32)
  • TUBERCULIST: Probable iron-regulated phosphoenolpyruvate carboxykinase [GTP] PckA (phosphoenolpyruvate carboxylase) (PEPCK)(pep carboxykinase)
  • NCBI: Probable iron-regulated phosphoenolpyruvate carboxykinase [GTP] PckA (phosphoenolpyruvate carboxylase) (PEPCK)(pep carboxykinase)
  • updated information (H37Rv4):
    • gene name: pckA
    • function:
    • reference:
• Type: Not Target
• Start: 251782
• End: 253602
• Operon:


• Trans-membrane region:
  
• Role: I.C.2 - Gluconeogenesis
• GO terms:
  • GO:0052572 - response to host immune response (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0017076 - purine nucleotide binding (Uniprot)
  • GO:0016831 - carboxy-lyase activity (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0010106 - cellular response to iron ion starvation (Uniprot)
  • GO:0006094 - gluconeogenesis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005525 - GTP binding (Uniprot)
  • GO:0004613 - phosphoenolpyruvate carboxykinase (GTP) activity (Uniprot)
  • GO:0004611 - phosphoenolpyruvate carboxykinase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GDP[c] + CO2[c] + PEP[c] <=> GTP[c] + OA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4WPT	100%	Mycobacterium tuberculosis	Crystal Structure of Mtb PEPCK in complex with PEP
  4WOU	100%	Mycobacterium tuberculosis	Crystal Structure of Mtb PEPCK in complex with GDP and metals
  4WL8	100%	Mycobacterium tuberculosis	Crystal Structure of Mtb PEPCK in complex with non-hydrolyzable analog of GTP
  4WIU	100%	Mycobacterium tuberculosis	Crystal Structure of PEPCK (Rv0211) from Mycobacterium tuberculosis in complex with oxalate and Mn2+
  4WIE	100%	Mycobacterium tuberculosis	Crystal structure of apo-PEPCK from Mycobacterium tuberculosis with glycerol
  4R43	100%	Mycobacterium tuberculosis H37Rv	Crystal Structure Analysis of MTB PEPCK
  5I67	99%	Mycobacterium tuberculosis H37Ra	Crystal Structure Analysis of MTB PEPCK mutant C273S
  4WPV	99%	Mycobacterium tuberculosis	Crystal Structure of E83A mutant of Mtb PEPCK in complex with Zn2+ and phosphate ion
  4WPU	99%	Mycobacterium tuberculosis	Crystal Structure of E83A mutant of Mtb PEPCK in complex with PEP and GDP
  4RCG	99%	Mycobacterium tuberculosis H37Rv	Crystal Structure Analysis of MTB PEPCK without Mn+2

• Links to additional information on pckA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.051 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC

Amino Acid Sequence

MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRLCDQLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTN
NWMDPGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRMGKAALEKMGDDGFFVKALHSVGAPLEPGQKDVAWPCSE
TKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGNTVFTNVALTDDGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPIL
APEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTAAAEGKVGNVRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVN
WFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLDLDGLDVDAADVAAALAVDADEWRQELPLIEEWLQFVGEKLPTGVKDEFDA
LKERLG

Additional Information