TB Genome Annotation Portal

Rv0199 (-)

Amino Acid Sequence

MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIASTLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNID
ASLQRLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVVTTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLR
LDVSDVDGKLMISRLESIR
(Nucleotide sequence available on KEGG)

Additional Information

OmamA - Mce1-associated protein required for cholesterol transport
Perkowski et al (2016). An orphaned Mce-associated membrane protein of Mycobacterium tuberculosis is a virulence factor that stabilizes Mce transporters. https://pubmed.ncbi.nlm.nih.gov/26712165/

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0199/-, gene len: 659 bp, num TA sites: 12
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASessentialBL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.99)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeYES (LFC=-1.717)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.01)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.21 (0.13)0.71 (0.26)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0199 (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv0200shahanup86NASCo-expression (Functional linkage)
    authors,GR. Stewart,J. Patel,BD. Robertson,A. Rae,DB. Young Mycobacterial mutants with defective control of phagosomal acidification. PLoS Pathog. 2005
    InteractionPhysicalInteraction Rv0200yashabhasinNASCo-expression (Functional linkage)
    authors,GR. Stewart,J. Patel,BD. Robertson,A. Rae,DB. Young Mycobacterial mutants with defective control of phagosomal acidification. PLoS Pathog. 2005
    CitationMycobacterial mutants with defective control of phagosomal acidification. authors,GR. Stewart,J. Patel,BD. Robertson,A. Rae,DB. Young PLoS Pathog. 2005shahanup86NAS16322769Co-expression (Functional linkage)

    Comments