TB Genome Annotation Portal

Rv0172 (mce1D)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: virulence factor Mce family protein
  • REFSEQ: MCE-family protein MCE1D
  • PATRIC: MCE-family protein Mce1D
  • TUBERCULIST: Mce-family protein Mce1D
  • NCBI: Mce-family protein Mce1D
  • updated information (H37Rv4):
    • gene name: mce1D
    • function:
    • reference:
• Type: Conditional
• Start: 202476
• End: 204068
• Operon:


• Trans-membrane region:
  
• Role: IV.A - Virulence
• GO terms:
  • GO:0044117 - growth of symbiont in host (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0016042 - lipid catabolic process (FLUTE) (FLUTE Assigned!)
  • GO:0006979 - response to oxidative stress (FLUTE) (FLUTE Assigned!Y2 report, Nambi et al.)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on mce1D:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.71 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

LSTIFDIRNLRLPQLSRASVVIGSLVVVLALAAGIVGVRLYQKLTNNTVVAYFTQANALYVGDKVQIMGLPVGSIDKIEPAGDKMKVTFHYQNKYKVPAN
ASAVILNPTLVASRNIQLEPPYRGGPVLADNAVIPVERTQVPTEWDELRDSVSHIIDELGPTPEQPKGPFGEVIEAFADGLAGKGKQINTTLNSLSQALN
ALNEGRGDFFAVVRSLALFVNALHQDDQQFVALNKNLAEFTDRLTHSDADLSNAIQQFDSLLAVARPFFAKNREVLTHDVNNLATVTTTLLQPDPLDGLE
TVLHIFPTLAANINQLYHPTHGGVVSLSAFTNFANPMEFICSSIQAGSRLGYQESAELCAQYLAPVLDAIKFNYFPFGLNVASTASTLPKEIAYSEPRLQ
PPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVAPGMQGVQVGPITQGLLTPESLAELMGGPDIAPPSSGLQTPPGPPNAYDEYPVLPPIGLQAPQVPIPPP
PPGPDVIPGPVPPTPAPVGAPLPAEAGGGQ

Additional Information