Rv0167 (yrbE1A)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: ABC transporter permease
REFSEQ: integral membrane protein YRBE1A
PATRIC: Conserved hypothetical integral membrane protein YrbE1A
TUBERCULIST: Conserved integral membrane protein YrbE1A
NCBI: Conserved integral membrane protein YrbE1A
updated information (H37Rv4):
gene name: yrbE1A
function:
reference:
Coordinates in H37Rv: 196861 - 197658
Gene length: 798 bp (with stop codon), 265 aa (without stop codon)
Operon:
Trans-membrane region:
Role: IV.A - Virulence
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on yrbE1A:
Amino Acid Sequence
VTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWREFILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQ
LGPLTTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGLVITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEV
VIATIKAATFGLIAGLVGCYRGLTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0167/yrbE1A,
gene len: 797 bp, num TA sites: 7
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro no data 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=2.55) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=-1.054) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-1.53) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0167: 0.717599988
lineage-specific pN/pS in L1: 0.432932224
lineage-specific pN/pS in L2: 0.919980977
lineage-specific pN/pS in L3: 0.595281809
lineage-specific pN/pS in L4: 0.853131148
Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods )
Moldova: 2,057 clinical isolates
global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
Moldova (2,057) global set (5,195)
under significant positive selection? NO NO
omega peak height (95%CI lower bound) 1.73 (0.35) 0.86 (0.36)
codons under selection
omega plots
genetic variants* link link
statistics at each codon link link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction PhysicalInteraction Rv0655 priyadarshinipriyanka2001 IEP Co-expression (Functional linkage)authors,SM. Joshi,AK. Pandey,N. Capite,SM. Fortune,EJ. Rubin,CM. Sassetti Characterization of mycobacterial virulence genes through genetic interaction mapping. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction Regulatory Rv0174 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0173 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0172 shahanup86 TAS Operon (Functional linkage)M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction Regulatory Rv0172 shahanup86 TAS Operon (Functional linkage)M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction Regulatory Rv0172 shahanup86 TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0171 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0170 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0173 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0174 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0168 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Citation Regulation of the Mycobacterium tuberculosis mce1 operon. N. Casali, AM. White et al. J. Bacteriol. 2006 yashabhasin IEP 16385033 Co-expression (Functional linkage)
Interaction RegulatedBy Rv0165c yashabhasin IEP Co-expression (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Citation Regulation of the Mycobacterium tuberculosis mce1 operon. N. Casali, AM. White et al. J. Bacteriol. 2006 yashabhasin TAS 16385033 Operon (Functional linkage)
Interaction Regulatory Rv0166 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0168 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0169 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0170 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0171 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0172 yashabhasin TAS Operon (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction Regulatory Rv0165c yashabhasin IEP Co-expression (Functional linkage)N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction RegulatedBy Rv0348 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction RegulatedBy Rv0348 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction RegulatedBy Rv0981 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction RegulatedBy Rv1221 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001