Rv0127 (mak)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: hypothetical protein
REFSEQ: hypothetical protein
PATRIC: Uncharacterized protein probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]
TUBERCULIST: Maltokinase Mak
NCBI: Maltokinase Mak
updated information (H37Rv4):
gene name: mak
function:
reference: Fraga (2015) PMID: 25619172
Coordinates in H37Rv: 154232 - 155599
Gene length: 1368 bp (with stop codon), 455 aa (without stop codon)
Operon:
Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 4O7P 100% Mycobacterium tuberculosis Crystal structure of Mycobacterium tuberculosis maltose kinase MaK complexed with maltose 4O7O 100% Mycobacterium tuberculosis Crystal structure of Mycobacterium tuberculosis maltose kinase MaK 5JY7 65% Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Complex of Mycobacterium smegmatis trehalose synthase with maltokinase 4WZY 59% Mycobacterium vanbaalenii Structure of mycobacterial maltokinase, the missing link in the essential GlgE-pathway (ATP complex) 4U98 59% Mycobacterium vanbaalenii Structure of mycobacterial maltokinase, the missing link in the essential GlgE-pathway (AppCp complex) 4U94 59% Mycobacterium vanbaalenii Structure of mycobacterial maltokinase, the missing link in the essential GlgE-pathway
Links to additional information on mak:
Amino Acid Sequence
MTRSDTLATKLPWSDWLSRQRWYAGRNRELATVKPGVVVALRHNLDLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGP
QFLLSLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVSSGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSP
TDALAYALGMVTEYEANAAEGWAMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRMLARLSSTVAVVPELREYAP
TIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAAF
CDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0127/mak,
gene len: 1367 bp, num TA sites: 30
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-2.11) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.0) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys growth defect YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys YES (LFC=-5.13) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0127: 0.544635102
lineage-specific pN/pS in L1: 0.365722201
lineage-specific pN/pS in L2: 0.725224636
lineage-specific pN/pS in L3: 0.51919491
lineage-specific pN/pS in L4: 0.605475113
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.31 (0.52)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Symbol pep2 mjackson IMP Other (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
Name Maltokinase mjackson IMP Other (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
Symbol pep2 mjackson IDA Other (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
Name Maltokinase mjackson IDA Other (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
Symbol pep2 mjackson Maltokinase (phenotypic [mycobacterial recombinant strains]; enzymatic)R. Kalscheuer,K. Syson,U. Veeraraghavan,B. Weinrick,KE. Biermann,Z. Liu,JC. Sacchettini,G. Besra,S. Bornemann,WR. Jacobs Self-poisoning of Mycobacterium tuberculosis by targeting GlgE in an alpha-glucan pathway. Nature chemical biology 2010
Citation Self-poisoning of Mycobacterium tuberculosis by targeting GlgE in an alpha-glucan pathway. R. Kalscheuer,K. Syson,U. Veeraraghavan,B. Weinrick,KE. Biermann,Z. Liu,JC. Sacchettini,G. Besra,S. Bornemann,WR. Jacobs Nature chemical biology 2010 mjackson 20305657 Maltokinase (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other TBPWY:(MGLP and alpha-1,4 glucans) mjackson Maltokinase (phenotypic [mycobacterial recombinant strains]; enzymatic)R. Kalscheuer,K. Syson,U. Veeraraghavan,B. Weinrick,KE. Biermann,Z. Liu,JC. Sacchettini,G. Besra,S. Bornemann,WR. Jacobs Self-poisoning of Mycobacterium tuberculosis by targeting GlgE in an alpha-glucan pathway. Nature chemical biology 2010
Symbol pep2 mjackson Maltokinase (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,V. Mendes,A. Maranha,P. Lamosa,MS. da Costa,N. Empadinhas Biochemical characterization of the maltokinase from Mycobacterium bovis BCG. BMC Biochem. 2010
Citation Biochemical characterization of the maltokinase from Mycobacterium bovis BCG. authors,V. Mendes,A. Maranha,P. Lamosa,MS. da Costa,N. Empadinhas BMC Biochem. 2010 mjackson 20507595 Maltokinase (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other TBPWY:(MGLP and alpha-1,4 glucans) mjackson Maltokinase (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,V. Mendes,A. Maranha,P. Lamosa,MS. da Costa,N. Empadinhas Biochemical characterization of the maltokinase from Mycobacterium bovis BCG. BMC Biochem. 2010