TB Genome Annotation Portal

Rv0127 (mak)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: hypothetical protein
  • PATRIC: Uncharacterized protein probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]
  • TUBERCULIST: Maltokinase Mak
  • NCBI: Maltokinase Mak
  • updated information (H37Rv4):
    • gene name: mak
    • function:
    • reference: Fraga (2015) PMID: 25619172
• Type: Essential
• Start: 154232
• End: 155599
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0046835 - carbohydrate phosphorylation (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0005992 - trehalose biosynthetic process (Uniprot)
  • GO:0005978 - glycogen biosynthetic process (Uniprot)
  • GO:0005977 - glycogen metabolic process (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0009252 - peptidoglycan biosynthetic process (FLUTE) (FLUTE Assigned!)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + MLT[c] -> ADP[c] + MLT1P[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4O7P	100%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis maltose kinase MaK complexed with maltose
  4O7O	100%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis maltose kinase MaK
  5JY7	65%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Complex of Mycobacterium smegmatis trehalose synthase with maltokinase
  4WZY	59%	Mycobacterium vanbaalenii	Structure of mycobacterial maltokinase, the missing link in the essential GlgE-pathway (ATP complex)
  4U98	59%	Mycobacterium vanbaalenii	Structure of mycobacterial maltokinase, the missing link in the essential GlgE-pathway (AppCp complex)
  4U94	59%	Mycobacterium vanbaalenii	Structure of mycobacterial maltokinase, the missing link in the essential GlgE-pathway

• Links to additional information on mak:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.279 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTRSDTLATKLPWSDWLSRQRWYAGRNRELATVKPGVVVALRHNLDLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGP
QFLLSLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVSSGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSP
TDALAYALGMVTEYEANAAEGWAMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRMLARLSSTVAVVPELREYAP
TIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAAF
CDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS

Additional Information

pep2

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.43 (0.27)	1.01 (0.48)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link