TB Genome Annotation Portal

Rv0054 (ssb)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: single-stranded DNA-binding protein
  • REFSEQ: single-stranded DNA-binding protein
  • PATRIC: Single-stranded DNA-binding protein
  • TUBERCULIST: Single-strand binding protein Ssb (helix-destabilizing protein)
  • NCBI: Single-strand binding protein Ssb (helix-destabilizing protein)
  • updated information (H37Rv4):
    • gene name: ssb
    • function:
    • reference:
• Type: Not Target
• Start: 58586
• End: 59080
• Operon:


• Trans-membrane region:
  
• Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
• GO terms:
  • GO:0046677 - response to antibiotic (Uniprot)
  • GO:0006974 - cellular response to DNA damage stimulus (Uniprot)
  • GO:0006260 - DNA replication (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0003697 - single-stranded DNA binding (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 1ue6, 1ue7, 1ue5, 1ue1
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1UE7	99%	Mycobacterium tuberculosis	Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
  1UE6	99%	Mycobacterium tuberculosis	Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
  1UE5	99%	Mycobacterium tuberculosis	Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
  1UE1	99%	Mycobacterium tuberculosis	Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
  3A5U	92%	Mycobacterium smegmatis	Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex
  3AFQ	89%	Mycobacterium leprae	Crystal structure of the single-stranded DNA binding protein from Mycobacterium leprae (Form II)
  3AFP	89%	Mycobacterium leprae	Crystal structure of the single-stranded DNA binding protein from Mycobacterium leprae (Form I)
  1X3G	84%	Mycobacterium smegmatis	Crystal structure of the single-stranded DNA-binding protein from Mycobacterium SMEGMATIS
  1X3F	84%	Mycobacterium smegmatis	Crystal structure of the single-stranded DNA-binding protein from Mycobacterium SMEGMATIS
  1X3E	84%	Mycobacterium smegmatis	Crystal structure of the single-stranded DNA-binding protein from Mycobacterium smegmatis

• Links to additional information on ssb:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -10.732 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTGEWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIE
VEVDEIGPSLRYATAKVNKASRSGGFGSGSRPAPAQTSSASGDDPWGSAPASGSFGGGDDEPPF

Additional Information