Rv0048c (-)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: membrane protein
REFSEQ: hypothetical protein
PATRIC: Possible membrane protein
TUBERCULIST: Possible membrane protein
NCBI: Possible membrane protein
updated information (H37Rv4):
gene name: -
function:
reference:
Coordinates in H37Rv: 51828 - 52697
Gene length: 870 bp (with stop codon), 289 aa (without stop codon)
Operon:
Trans-membrane region:
Role: VI - Unknowns
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): (none with >35% aa id)
Links to additional information on Rv0048c:
Amino Acid Sequence
VAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEHRERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASV
LLGVGIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTMGYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDAT
SSAKSIADVSVVDLSKFDAKTAVGIMRGAPETLGLKQSDVKSMYLIVEPVKDPTTPAALSLSLYVSSDYGGGYLVFAGDGTIKHVSYPS
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0048c/-,
gene len: 869 bp, num TA sites: 16
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.06) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.193) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-0.31) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0048c: 0.822774915
lineage-specific pN/pS in L1: 0.610713273
lineage-specific pN/pS in L2: 1.189283741
lineage-specific pN/pS in L3: 0.913507801
lineage-specific pN/pS in L4: 0.825891487
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.36 (0.72)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction Operon Rv0047c priti.priety IDA Structural AnalysisF. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Citation Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall J. Proteome Res. null priti.priety IDA 15952732 Structural Analysis
Interaction Operon Rv0046c priti.priety IDA Structural Analysisauthors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction Operon Rv0047c priti.priety IDA Structural Analysisauthors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction Operon Rv0047c priti.priety IDA SpectrophotometricF. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Citation Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall J. Proteome Res. null priti.priety IDA 15952732 Spectrophotometric
Interaction Operon Rv0046c priti.priety IDA Spectrophotometricauthors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction Operon Rv0047c priti.priety IDA Spectrophotometricauthors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Citation Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. N. Scherr, S. Honnappa et al. Proc. Natl. Acad. Sci. U.S.A. 2007 priti.priety IDA 17616581 Structural Analysis
Interaction Operon Rv0046c priti.priety IDA Structural AnalysisN. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction Operon Rv0047c priti.priety IDA Structural AnalysisN. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Citation The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. F. Movahedzadeh, DA. Smith et al. Mol. Microbiol. 2004 priti.priety IDA 14763976 Structural Analysis
Interaction Operon Rv0046c priti.priety IDA Structural AnalysisF. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction Operon Rv0047c priti.priety IDA Structural AnalysisF. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction Operon Rv0047c priti.priety IDA Structural Analysisauthors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
Citation Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. N. Scherr, S. Honnappa et al. Proc. Natl. Acad. Sci. U.S.A. 2007 priti.priety IDA 17616581 Spectrophotometric
Interaction Operon Rv0046c priti.priety IDA SpectrophotometricN. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction Operon Rv0047c priti.priety IDA SpectrophotometricN. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Citation The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. F. Movahedzadeh, DA. Smith et al. Mol. Microbiol. 2004 priti.priety IDA 14763976 Spectrophotometric
Interaction Operon Rv0046c priti.priety IDA SpectrophotometricF. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction Operon Rv0047c priti.priety IDA SpectrophotometricF. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction Operon Rv0047c priti.priety IDA Spectrophotometricauthors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004