TB Genome Annotation Portal

Rv0046c (ino1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: inositol-3-phosphate synthase
  • REFSEQ: myo-inositol-1-phosphate synthase INO1 (inositol 1-phosphate synthetase) (D-glucose 6-phosphate cycloaldolase) (glucose 6-phosphate cyclase) (glucocycloaldolase)
  • PATRIC: Inositol-1-phosphate synthase (EC 5.5.1.4)
  • TUBERCULIST: myo-inositol-1-phosphate synthase Ino1 (inositol 1-phosphate synthetase) (D-glucose 6-phosphate cycloaldolase) (glucose 6-phosphate cyclase) (glucocycloaldolase)
  • NCBI: myo-inositol-1-phosphate synthase Ino1 (inositol 1-phosphate synthetase) (D-glucose 6-phosphate cycloaldolase) (glucose 6-phosphate cyclase) (glucocycloaldolase)
  • updated information (H37Rv4):
    • gene name: ino1
    • function:
    • reference:
• Type: Not Target
• Start: 50021
• End: 51124
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0016853 - isomerase activity (Uniprot)
  • GO:0010125 - mycothiol biosynthetic process (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0008654 - phospholipid biosynthetic process (Uniprot)
  • GO:0008270 - zinc ion binding (Uniprot)
  • GO:0006021 - inositol biosynthetic process (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0004512 - inositol-3-phosphate synthase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • bDG6P[c] <=> IP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 1gr0
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1GR0	100%	MYCOBACTERIUM TUBERCULOSIS	myo-inositol 1-phosphate synthase from Mycobacterium tuberculosis in complex with NAD and zinc.
  6K96	36%	Streptomyces citricolor	Crystal structure of Ari2

• Links to additional information on ino1:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -5.01 (from Jeremy Rock's lab)
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSEHQSLPAPEASTEVRVAIVGVGNCASSLVQGVEYYYNADDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTN
VIVQRGPTLDGIGKYYADTIELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAIDAGVAFVNALPVFIASDPVWAKKFTDARVPIVGDDIKS
QVGATITHRVLAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTSNLKREFKTKDVHIGPSDHVGWLDDRKWAYVRLEGRAFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASAYLMKSPPEQLPDDIARAQLEEFIIG

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.04 (0.14)	1.33 (0.55)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link