Rv0046c (ino1)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: inositol-3-phosphate synthase
- REFSEQ: myo-inositol-1-phosphate synthase INO1 (inositol 1-phosphate synthetase) (D-glucose 6-phosphate cycloaldolase) (glucose 6-phosphate cyclase) (glucocycloaldolase)
- PATRIC: Inositol-1-phosphate synthase (EC 5.5.1.4)
- TUBERCULIST: myo-inositol-1-phosphate synthase Ino1 (inositol 1-phosphate synthetase) (D-glucose 6-phosphate cycloaldolase) (glucose 6-phosphate cyclase) (glucocycloaldolase)
- NCBI: myo-inositol-1-phosphate synthase Ino1 (inositol 1-phosphate synthetase) (D-glucose 6-phosphate cycloaldolase) (glucose 6-phosphate cyclase) (glucocycloaldolase)
- updated information (H37Rv4):
  - gene name: ino1
  - function:
  - reference:
Type: Not Target
Start: 50021
End: 51124
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0016853 - isomerase activity (Uniprot)
- GO:0010125 - mycothiol biosynthetic process (Uniprot)
- GO:0009405 - pathogenesis (Uniprot)
- GO:0008654 - phospholipid biosynthetic process (Uniprot)
- GO:0008270 - zinc ion binding (Uniprot)
- GO:0006021 - inositol biosynthetic process (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0004512 - inositol-3-phosphate synthase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- bDG6P[c] <=> IP[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 1gr0
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
1GR0	100%	MYCOBACTERIUM TUBERCULOSIS	myo-inositol 1-phosphate synthase from Mycobacterium tuberculosis in complex with NAD and zinc.
6K96	36%	Streptomyces citricolor	Crystal structure of Ari2

Links to additional information on ino1:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -5.01 (from Jeremy Rock's lab)
- BioCyc
- Systems Biology

Amino Acid Sequence

MSEHQSLPAPEASTEVRVAIVGVGNCASSLVQGVEYYYNADDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTN
VIVQRGPTLDGIGKYYADTIELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAIDAGVAFVNALPVFIASDPVWAKKFTDARVPIVGDDIKS
QVGATITHRVLAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTSNLKREFKTKDVHIGPSDHVGWLDDRKWAYVRLEGRAFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASAYLMKSPPEQLPDDIARAQLEEFIIG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999800; 16 non-insertions in a row out of 16 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 16 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 16 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 17 non-insertions in a row out of 17 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 17 non-insertions in a row out of 17 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.42
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0047c (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0047c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0047c (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Operon Rv0048c	priti.priety	IDA		Structural Analysis F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0048c	priti.priety	IDA		Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	Operon Rv0048c	priti.priety	IDA		Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	Operon Rv0048c	priti.priety	IDA		Structural Analysis N. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Operon Rv0047c	priti.priety	IDA		Structural Analysis authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
Interaction	Operon Rv0048c	priti.priety	IDA		Spectrophotometric N. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Operon Rv0048c	priti.priety	IDA		Spectrophotometric F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0047c	priti.priety	IDA		Spectrophotometric F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0047c	priti.priety	IDA		Spectrophotometric authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
Interaction	Operon Rv0047c	priti.priety	IDA		Structural Analysis F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Citation	Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. MD. Santangelo, LI. Klepp et al. Microbiology (Reading, Engl.) 2009	shahanup86	IMP	19389781	None
Interaction	Inhibition Rv1963c	shahanup86	IMP		MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	RegulatedBy Rv1963c	yamir.moreno	IEP		Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

TB Genome Annotation Portal