TB Genome Annotation Portal

Rv0015c (pknA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: serine/threonine protein kinase
  • REFSEQ: transmembrane serine/threonine-protein kinase A PKNA (protein kinase A) (STPK A)
  • PATRIC: Serine/threonine-protein kinase PknA (EC 2.7.11.1)
  • TUBERCULIST: Transmembrane serine/threonine-protein kinase A PknA (protein kinase A) (STPK A)
  • NCBI: Transmembrane serine/threonine-protein kinase A PknA (protein kinase A) (STPK A)
  • updated information (H37Rv4):
    • gene name: pknA
    • function:
    • reference:
• Type: Not Target
• Start: 17467
• End: 18762
• Operon:


• Trans-membrane region:
  
• Role: I.J.3 - Serine-Threonine protein kinases and phosphoprotein phosphatases
• GO terms:
  • GO:0051055 - negative regulation of lipid biosynthetic process (Uniprot)
  • GO:0046777 - protein autophosphorylation (Uniprot)
  • GO:0045717 - negative regulation of fatty acid biosynthetic process (Uniprot)
  • GO:0043388 - positive regulation of DNA binding (Uniprot)
  • GO:0043086 - negative regulation of catalytic activity (Uniprot)
  • GO:0043085 - positive regulation of catalytic activity (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0008360 - regulation of cell shape (Uniprot)
  • GO:0006468 - protein phosphorylation (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004674 - protein serine/threonine kinase activity (Uniprot)
  • GO:0004672 - protein kinase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6B2Q	100%	Mycobacterium tuberculosis	Dual Inhibition of the Essential Protein Kinases A and B in Mycobacterium tuberculosis
  4X3F	100%	Mycobacterium tuberculosis	Crystal structure of the intracellular domain of the M. tuberculosis Ser/Thr kinase PknA
  4X3F	100%	Mycobacterium tuberculosis	Crystal structure of the intracellular domain of the M. tuberculosis Ser/Thr kinase PknA
  4X3F	100%	Mycobacterium tuberculosis	Crystal structure of the intracellular domain of the M. tuberculosis Ser/Thr kinase PknA
  4OW8	100%	Mycobacterium tuberculosis	Crystal structure of kinase domain of PknA from Mtb
  6B2P	42%	Mycobacterium tuberculosis	Dual Inhibition of the Essential Protein Kinases A and B in Mycobacterium tuberculosis
  5U94	42%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of the Mycobacterium tuberculosis PASTA kinase PknB in complex with the potential theraputic kinase inhibitor GSK690693.
  2FUM	42%	Mycobacterium tuberculosis H37Rv	Catalytic domain of protein kinase PknB from Mycobacterium tuberculosis in complex with mitoxantrone
  1O6Y	42%	MYCOBACTERIUM TUBERCULOSIS	Catalytic domain of PknB kinase from Mycobacterium tuberculosis
  6I2P	42%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of the Mycobacterium tuberculosis PknB kinase domain (L33E mutant) in complex with its substrate GarA

• Links to additional information on pknA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -7.402 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDV
YSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSG
TTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTE
RGETRHSGLQSWVVPPTPHSRASLARYEIAQ

Additional Information