TB Genome Annotation Portal

Rv0015c (pknA)

Amino Acid Sequence

MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNG
EPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDV
YSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSG
TTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTE
RGETRHSGLQSWVVPPTPHSRASLARYEIAQ
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.91 (0.51)1.07 (0.54)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0015c/pknA, gene len: 1295 bp, num TA sites: 16
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.91)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.494)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysgrowth defectYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, vitamins)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-1.55)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0015c (pknA)

    PropertyValueCreatorEvidencePMIDComment
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,OW. Schonecke,W. Schffel Evaluation of combined pharmacological and psychotherapeutic treatment in patients with functional abdominal disorders. Psychother Psychosom 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,PW. Hermans,F. Abebe,VI. Kuteyi,AH. Kolk,JE. Thole,M. Harboe Molecular and immunological characterization of the highly conserved antigen 84 from Mycobacterium tuberculosis and Mycobacterium leprae. Infect. Immun. 1995
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,D. Bucens,MC. Pain Influence of hematocrit, blood gas tensions, and pH on pressure-flow relations in the isolated canine lung. Circ. Res. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,H. Autrup,GP. Warwick Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity. Chem. Biol. Interact. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,JM. Stein The effect of adrenaline and of alpha- and beta-adrenergic blocking agents on ATP concentration and on incorporation of 32Pi into ATP in rat fat cells. Biochem. Pharmacol. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,K. Hamasha,MB. Sahana,C. Jani,S. Nyayapathy,CM. Kang,SJ. Rehse The effect of Wag31 phosphorylation on the cells and the cell envelope fraction of wild-type and conditional mutants of Mycobacterium smegmatis studied by visible-wavelength Raman spectroscopy. Biochem. Biophys. Res. Commun. 2010
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionSignaling Rv0018cvmevada102IDASpectrophotometric Analysis
    P. Chopra, B. Singh et al. Phosphoprotein phosphatase of Mycobacterium tuberculosis dephosphorylates serine-threonine kinases PknA and PknB. Biochem. Biophys. Res. Commun. 2003
    InteractionSignaling Rv0018cvmevada102IDASpectrophotometric Analysis
    B. Boitel, M. Ortiz-Lombarda et al. PknB kinase activity is regulated by phosphorylation in two Thr residues and dephosphorylation by PstP, the cognate phospho-Ser/Thr phosphatase, in Mycobacterium tuberculosis. Mol. Microbiol. 2003
    CitationThe Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. CM. Kang, DW. Abbott et al. Genes Dev. 2005vmevada102IEP15985609Functional linkage (Co-expression)
    InteractionSignaling Rv0014cvmevada102IEPFunctional linkage (Co-expression)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    CitationInterdomain interaction reconstitutes the functionality of PknA, a eukaryotic type Ser/Thr kinase from Mycobacterium tuberculosis. M. Thakur, R. Chaba et al. J. Biol. Chem. 2008vmevada102IEP18199749Co-expression (Functional linkage)
    InteractionSignaling Rv0015cvmevada102IEPCo-expression (Functional linkage)
    M. Thakur, R. Chaba et al. Interdomain interaction reconstitutes the functionality of PknA, a eukaryotic type Ser/Thr kinase from Mycobacterium tuberculosis. J. Biol. Chem. 2008
    InteractionSignaling Rv0015cvmevada102IEPCo-expression (Functional linkage)
    M. Thakur, R. Chaba et al. Interdomain interaction reconstitutes the functionality of PknA, a eukaryotic type Ser/Thr kinase from Mycobacterium tuberculosis. J. Biol. Chem. 2008
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IEP17148687Functional linkage (Co-expression)
    InteractionSignaling Rv0014cvmevada102IEPFunctional linkage (Co-expression)
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    InteractionSignaling Rv0014cvmevada102IDAStructural Analysis
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    InteractionSignaling Rv0014cvmevada102IDAStructural Analysis
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionSignaling Rv0014cvmevada102IPISpectrophotometric
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    InteractionSignaling Rv0014cvmevada102IPISpectrophotometric
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionSignaling Rv0014cvmevada102IDASpectrophotometric
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    InteractionSignaling Rv0014cvmevada102IDASpectrophotometric
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionSignaling Rv0014cvmevada102IPIStructural Analysis
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    InteractionSignaling Rv0014cvmevada102IPIStructural Analysis
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionSignaling Rv0014cvmevada102IPIAffinity purification (Physical interaction)
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    InteractionSignaling Rv0014cvmevada102IPIAffinity purification (Physical interaction)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionSignaling Rv0014cvmevada102IDAAffinity purification (Physical interaction)
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    InteractionSignaling Rv0014cvmevada102IDAAffinity purification (Physical interaction)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    NameTRANSMEMBRANE SERINE/THREONINE-PROTEIN KINASE, known to phosphorylate KasA, KasB, FabH, InhA and Pks13mjacksonIDARegulatory proteins

    Comments