TB Genome Annotation Portal

Rv0014c (pknB)

Amino Acid Sequence

MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTL
RDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVY
SLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTDAERTSLLSSA
AGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLAVLTVVVTIAINTFGGITRDVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVI
GTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAITNVVIIIVGSGPATKDIPDV
AGQTVDVAQKNLNVYGFTKFSQASVDSPRPAGEVTGTNPPAGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQH
NRVVYQNPPAGTGVNRDGIITLRFGQ
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
24 non-insertions in a row out of 24 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
24 non-insertions in a row out of 24 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
24 non-insertions in a row out of 24 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
24 non-insertions in a row out of 24 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
24 non-insertions in a row out of 24 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.05
Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    RNA processing and modification
    Energy production and conversion
    Chromatin structure and dynamics
    Amino acid transport and metabolism
    Cell cycle control, cell division, chromosome partitioning
    Carbohydrate transport and metabolism
    Nucleotide transport and metabolism
    Lipid transport and metabolism
    Coenzyme transport and metabolism
    Transcription
    Translation, ribosomal structure and biogenesis
    Cell wall/membrane/envelope biogenesis
    Replication, recombination and repair
    Posttranslational modification, protein turnover, chaperones
    Cell motility
    Secondary metabolites biosynthesis, transport and catabolism
    Inorganic ion transport and metabolism
    Function unknown
    General function prediction only
    Intracellular trafficking, secretion, and vesicular transport
    Signal transduction mechanisms
    Extracellular structures
    Defense mechanisms
    Nuclear structure
    Cytoskeleton
  • BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)
  • Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
    Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
  • BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)
  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0014c (pknB)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv3223csourish10TASCo-expression (Functional linkage)
    T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
    InteractionRegulatory Rv3223csourish10IEPCo-expression (Functional linkage)
    P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
    InteractionRegulatory Rv3223csourish10IEPCo-expression (Functional linkage)
    T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
    InteractionRegulatory Rv3223csourish10TASCo-expression (Functional linkage)
    P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,OW. Schonecke,W. Schffel Evaluation of combined pharmacological and psychotherapeutic treatment in patients with functional abdominal disorders. Psychother Psychosom 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,PW. Hermans,F. Abebe,VI. Kuteyi,AH. Kolk,JE. Thole,M. Harboe Molecular and immunological characterization of the highly conserved antigen 84 from Mycobacterium tuberculosis and Mycobacterium leprae. Infect. Immun. 1995
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,D. Bucens,MC. Pain Influence of hematocrit, blood gas tensions, and pH on pressure-flow relations in the isolated canine lung. Circ. Res. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,H. Autrup,GP. Warwick Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity. Chem. Biol. Interact. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,JM. Stein The effect of adrenaline and of alpha- and beta-adrenergic blocking agents on ATP concentration and on incorporation of 32Pi into ATP in rat fat cells. Biochem. Pharmacol. 1975
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    authors,K. Hamasha,MB. Sahana,C. Jani,S. Nyayapathy,CM. Kang,SJ. Rehse The effect of Wag31 phosphorylation on the cells and the cell envelope fraction of wild-type and conditional mutants of Mycobacterium smegmatis studied by visible-wavelength Raman spectroscopy. Biochem. Biophys. Res. Commun. 2010
    InteractionSignaling Rv2145charsharohiratruefriendIMPAffinity purification (Physical interaction)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionActivatedBy Rv1827madhulsbuIDASpectrophotometric
    A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
    InteractionActivatedBy Rv1827madhulsbuIDAStructural Analysis
    A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
    InteractionSignaling Rv1436yashabhasinIDASpectrophotometric
    authors,H. Nrnberger [Quantitative colorimetric determination of 1-(4-cyclohexylureidophenoxy)-2-hydroxy-3-tert butylaminopropane (talinolol Cordanum, 02-115) in body fluids]. Pharmazie 1975
    InteractionSignaling Rv1436yashabhasinIDASpectrophotometric
    authors,BK. Ratha,MS. Kanungo Induction of particulate and soluble isoenzymes of tyrosine aminotransferase by hydrocortisone in the liver of rats as a function of age. Biochem. Biophys. Res. Commun. 1977
    InteractionSignaling Rv1436yashabhasinIDAStructural Analysis
    authors,KV. Kaloustian,JJ. Poluhowich The role of organic phosphates in modulating the oxygenation behavior of eel hemoglobin. Comp Biochem Physiol A Comp Physiol 1976
    InteractionSignaling Rv1436yashabhasinIDAStructural Analysis
    authors,H. Nrnberger [Quantitative colorimetric determination of 1-(4-cyclohexylureidophenoxy)-2-hydroxy-3-tert butylaminopropane (talinolol Cordanum, 02-115) in body fluids]. Pharmazie 1975
    InteractionSignaling Rv1436yashabhasinIDAStructural Analysis
    authors,BK. Ratha,MS. Kanungo Induction of particulate and soluble isoenzymes of tyrosine aminotransferase by hydrocortisone in the liver of rats as a function of age. Biochem. Biophys. Res. Commun. 1977
    InteractionSignaling Rv1436yashabhasinIDASpectrophotometric
    authors,KV. Kaloustian,JJ. Poluhowich The role of organic phosphates in modulating the oxygenation behavior of eel hemoglobin. Comp Biochem Physiol A Comp Physiol 1976
    InteractionInhibits Rv1222harsharohiratruefriendIDAmass spectrometry
    S. Barik, K. Sureka et al. RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis. Mol. Microbiol. 2010
    InteractionInhibits Rv1222harsharohiratruefriendIDAmass spectrometry
    R. Manganelli,R. Provvedi,S. Rodrigue,J. Beaucher,L. Gaudreau,I. Smith,R. Proveddi Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 2004
    InteractionPhysicalInteraction Rv1018cashwinigbhatIDAStructural Analysis
    W. Zhang, VC. Jones et al. Expression, essentiality, and a microtiter plate assay for mycobacterial GlmU, the bifunctional glucosamine-1-phosphate acetyltransferase and N-acetylglucosamine-1-phosphate uridyltransferase. Int. J. Biochem. Cell Biol. 2008
    InteractionPhysicalInteraction Rv1018cashwinigbhatIDAStructural Analysis
    A. Parikh, SK. Verma et al. PknB-Mediated Phosphorylation of a Novel Substrate, N-Acetylglucosamine-1-Phosphate Uridyltransferase, Modulates Its Acetyltransferase Activity. J. Mol. Biol. 2008
    InteractionPhysicalInteraction Rv1018cpriti.prietyIDAStructural Analysis
    W. Zhang, VC. Jones et al. Expression, essentiality, and a microtiter plate assay for mycobacterial GlmU, the bifunctional glucosamine-1-phosphate acetyltransferase and N-acetylglucosamine-1-phosphate uridyltransferase. Int. J. Biochem. Cell Biol. 2008
    InteractionPhysicalInteraction Rv1018cpriti.prietyIDAStructural Analysis
    A. Parikh, SK. Verma et al. PknB-Mediated Phosphorylation of a Novel Substrate, N-Acetylglucosamine-1-Phosphate Uridyltransferase, Modulates Its Acetyltransferase Activity. J. Mol. Biol. 2008
    InteractionSignaling Rv0019cvmevada102IDASpectrophotometric Analysis
    M. Gupta,A. Sajid,G. Arora,V. Tandon,Y. Singh Forkhead-associated domain-containing protein Rv0019c and polyketide-associated protein PapA5, from substrates of serine/threonine protein kinase PknB to interacting proteins of Mycobacterium tuberculosis. J. Biol. Chem. 2009
    InteractionSignaling Rv0020cvmevada102IEPAffinity purification (Physical interaction)
    C. Grundner, LM. Gay et al. Mycobacterium tuberculosis serine/threonine kinases PknB, PknD, PknE, and PknF phosphorylate multiple FHA domains. Protein Sci. 2005
    InteractionSignaling Rv0018cvmevada102IDASpectrophotometric Analysis
    P. Chopra, B. Singh et al. Phosphoprotein phosphatase of Mycobacterium tuberculosis dephosphorylates serine-threonine kinases PknA and PknB. Biochem. Biophys. Res. Commun. 2003
    InteractionSignaling Rv0018cvmevada102IDASpectrophotometric Analysis
    B. Boitel, M. Ortiz-Lombarda et al. PknB kinase activity is regulated by phosphorylation in two Thr residues and dephosphorylation by PstP, the cognate phospho-Ser/Thr phosphatase, in Mycobacterium tuberculosis. Mol. Microbiol. 2003
    InteractionSignaling Rv0015cvmevada102IEPFunctional linkage (Co-expression)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    InteractionActivation Rv0016cvmevada102IEPCo-expression (Functional linkage)
    A. Dasgupta, P. Datta et al. The serine/threonine kinase PknB of Mycobacterium tuberculosis phosphorylates PBPA, a penicillin-binding protein required for cell division. Microbiology (Reading, Engl.) 2006
    CitationProteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. A. Villarino, R. Duran et al. J. Mol. Biol. 2005akankshajain.21IDA15978616Spectrophotometric
    InteractionSignaling Rv1827akankshajain.21IDASpectrophotometric
    A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
    CitationProteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. A. Villarino, R. Duran et al. J. Mol. Biol. 2005akankshajain.21IDA15978616Structural Analysis
    InteractionSignaling Rv1827akankshajain.21IDAStructural Analysis
    A. Villarino, R. Duran et al. Proteomic identification of M. tuberculosis protein kinase substrates: PknB recruits GarA, a FHA domain-containing protein, through activation loop-mediated interactions. J. Mol. Biol. 2005
    InteractionSignaling Rv0015cvmevada102IEPFunctional linkage (Co-expression)
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IDA17148687Structural Analysis
    InteractionSignaling Rv0015cvmevada102IDAStructural Analysis
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    CitationThe Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. CM. Kang, DW. Abbott et al. Genes Dev. 2005vmevada102IDA15985609Structural Analysis
    InteractionSignaling Rv0015cvmevada102IDAStructural Analysis
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    CitationThe Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. CM. Kang, DW. Abbott et al. Genes Dev. 2005vmevada102IPI15985609Spectrophotometric
    InteractionSignaling Rv0015cvmevada102IPISpectrophotometric
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IDA17148687Spectrophotometric
    InteractionSignaling Rv0015cvmevada102IDASpectrophotometric
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    CitationThe Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. CM. Kang, DW. Abbott et al. Genes Dev. 2005vmevada102IDA15985609Spectrophotometric
    InteractionSignaling Rv0015cvmevada102IDASpectrophotometric
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IPI17148687Structural Analysis
    InteractionSignaling Rv0015cvmevada102IPIStructural Analysis
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    CitationThe Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. CM. Kang, DW. Abbott et al. Genes Dev. 2005vmevada102IPI15985609Structural Analysis
    InteractionSignaling Rv0015cvmevada102IPIStructural Analysis
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IPI17148687Affinity purification (Physical interaction)
    InteractionSignaling Rv0015cvmevada102IPIAffinity purification (Physical interaction)
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    CitationThe Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. CM. Kang, DW. Abbott et al. Genes Dev. 2005vmevada102IPI15985609Affinity purification (Physical interaction)
    InteractionSignaling Rv0015cvmevada102IPIAffinity purification (Physical interaction)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IDA17148687Affinity purification (Physical interaction)
    InteractionSignaling Rv0015cvmevada102IDAAffinity purification (Physical interaction)
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    CitationThe Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. CM. Kang, DW. Abbott et al. Genes Dev. 2005vmevada102IDA15985609Affinity purification (Physical interaction)
    InteractionSignaling Rv0015cvmevada102IDAAffinity purification (Physical interaction)
    CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IPI17148687Spectrophotometric
    InteractionSignaling Rv0015cvmevada102IPISpectrophotometric
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    CitationThe serine/threonine kinase PknB of Mycobacterium tuberculosis phosphorylates PBPA, a penicillin-binding protein required for cell division. A. Dasgupta, P. Datta et al. Microbiology (Reading, Engl.) 2006vmevada102IEP16436437Co-expression (Functional linkage)
    InteractionSignaling Rv0016cvmevada102IEPCo-expression (Functional linkage)
    A. Dasgupta, P. Datta et al. The serine/threonine kinase PknB of Mycobacterium tuberculosis phosphorylates PBPA, a penicillin-binding protein required for cell division. Microbiology (Reading, Engl.) 2006
    CitationSerine threonine protein kinases of mycobacterial genus: phylogeny to function. A. Narayan, P. Sachdeva et al. Physiol. Genomics 2007vmevada102IEP17148687Co-expression (Functional linkage)
    InteractionSignaling Rv0016cvmevada102IEPCo-expression (Functional linkage)
    A. Narayan, P. Sachdeva et al. Serine threonine protein kinases of mycobacterial genus: phylogeny to function. Physiol. Genomics 2007
    NameTRANSMEMBRANE SERINE/THREONINE-PROTEIN KINASE, known to phosphorylate InhA;KasA, KasBmjacksonIDARegulatory proteins

    Comments