TB Genome Annotation Portal

Rv0011c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: UPF0233 membrane protein
  • REFSEQ: putative septation inhibitor protein
  • PATRIC: FIG018426: putative septation inhibitor protein
  • TUBERCULIST: Probable conserved transmembrane protein
  • NCBI: Probable conserved transmembrane protein
  • updated information (H37Rv4):
    • gene name: crgA
    • function: cell division protein
    • reference: Plocinski (2011) PMID: 21531798; Plocinski (2012) PMC3497543
• Type: Not Target
• Start: 13714
• End: 13995
• Operon:


• Trans-membrane region:
  
• Role: VI - Unknowns
• GO terms:
  • GO:0051301 - cell division (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0008360 - regulation of cell shape (Uniprot)
  • GO:0007049 - cell cycle (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2MMU	100%	Mycobacterium tuberculosis	Structure of CrgA, a Cell Division Structural and Regulatory Protein from Mycobacterium tuberculosis, in Lipid Bilayers

• Links to additional information on Rv0011c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -2.652 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Additional Information

CrgA
divisome component, cell-wall biosynthesis/division
co-localizes with FtsZ and FtsI; links FtsW and FtsQ
Plocinski (2011). https://jb.asm.org/content/193/13/3246

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.3 (0.16)	1.35 (0.58)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link