Rv0011c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: UPF0233 membrane protein
- REFSEQ: putative septation inhibitor protein
- PATRIC: FIG018426: putative septation inhibitor protein
- TUBERCULIST: Probable conserved transmembrane protein
- NCBI: Probable conserved transmembrane protein
- updated information (H37Rv4):
  - gene name: crgA
  - function: cell division protein
  - reference: Plocinski (2011) PMID: 21531798; Plocinski (2012) PMC3497543
Type: Not Target
Start: 13714
End: 13995
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- GO:0051301 - cell division (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0008360 - regulation of cell shape (Uniprot)
- GO:0007049 - cell cycle (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005515 - protein binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

2MMU 100% Mycobacterium tuberculosis Structure of CrgA, a Cell Division Structural and Regulatory Protein from Mycobacterium tuberculosis, in Lipid Bilayers
Links to additional information on Rv0011c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -2.652 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
2MMU	100%	Mycobacterium tuberculosis	Structure of CrgA, a Cell Division Structural and Regulatory Protein from Mycobacterium tuberculosis, in Lipid Bilayers

Amino Acid Sequence

MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

(Nucleotide sequence available on KEGG)

Additional Information

CrgA
divisome component, cell-wall biosynthesis/division
co-localizes with FtsZ and FtsI; links FtsW and FtsQ
Plocinski (2011). https://jb.asm.org/content/193/13/3246

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Too-Short	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Too-Short	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Too-Short	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Too-Short	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Too-Short	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.51
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1404 (-) (Direct binding)
- Rv1423 (whiA) (Direct binding)
- Rv2989 (-) (Direct binding)
- Rv3133c (devR) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	Mass spectrometry of intracellular and membrane proteins using cleavable detergents. authors,JL. Norris,NA. Porter,RM. Caprioli Anal. Chem. 2003	vmevada102	IDA	14640740	spectrometric analysis
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		spectrometric analysis authors,JL. Norris,NA. Porter,RM. Caprioli Mass spectrometry of intracellular and membrane proteins using cleavable detergents. Anal. Chem. 2003
Interaction	Inhibits Rv2150c	priti.priety	NAS		None
Interaction	Inhibits Rv2150c	ashwinigbhat	NAS		None
Citation	Analysis of the function of mycobacterial DnaJ proteins by overexpression and microarray profiling. GR. Stewart, BD. Robertson et al. Tuberculosis (Edinburgh, Scotland) 2004	shahanup86	IEP	15207487	Co-expression (Functional linkage)
Interaction	Regulatory Rv0352	shahanup86	IEP		Co-expression (Functional linkage) GR. Stewart, BD. Robertson et al. Analysis of the function of mycobacterial DnaJ proteins by overexpression and microarray profiling. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		Structural analysis authors,C. Ryall,G. Holt,WC. Noble Interactions between dermatophyte fungi and staphylococci or Brevibacterium in vitro. J. Invest. Dermatol. 1981
Citation	How long can a gastric erosion persist? authors,L. Walk Radiologe 1991	vmevada102	IDA	2006253	Structural analysis
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		Structural analysis authors,L. Walk How long can a gastric erosion persist? Radiologe 1991
Citation	Mass spectrometry of intracellular and membrane proteins using cleavable detergents. authors,JL. Norris,NA. Porter,RM. Caprioli Anal. Chem. 2003	vmevada102	IDA	14640740	Structural analysis
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		Structural analysis authors,JL. Norris,NA. Porter,RM. Caprioli Mass spectrometry of intracellular and membrane proteins using cleavable detergents. Anal. Chem. 2003
Citation	Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. authors,K. Moroi,T. Sato Biochem. Pharmacol. 1975	vmevada102	IDA	8	spectrometric analysis
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		spectrometric analysis authors,K. Moroi,T. Sato Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. Biochem. Pharmacol. 1975
Citation	Interactions between dermatophyte fungi and staphylococci or Brevibacterium in vitro. authors,C. Ryall,G. Holt,WC. Noble J. Invest. Dermatol. 1981	vmevada102	IDA	7462664	spectrometric analysis
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		spectrometric analysis authors,C. Ryall,G. Holt,WC. Noble Interactions between dermatophyte fungi and staphylococci or Brevibacterium in vitro. J. Invest. Dermatol. 1981
Citation	How long can a gastric erosion persist? authors,L. Walk Radiologe 1991	vmevada102	IDA	2006253	spectrometric analysis
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		spectrometric analysis authors,L. Walk How long can a gastric erosion persist? Radiologe 1991
Interaction	PhysicalInteraction Rv0008c	gaat3s	NAS		Gene Neighborhood (Functional linkage)
Citation	Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. authors,K. Moroi,T. Sato Biochem. Pharmacol. 1975	vmevada102	IDA	8	Structural analysis
Interaction	PhysicalInteraction Rv0008c	vmevada102	IDA		Structural analysis authors,K. Moroi,T. Sato Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. Biochem. Pharmacol. 1975
Citation	Interactions between dermatophyte fungi and staphylococci or Brevibacterium in vitro. authors,C. Ryall,G. Holt,WC. Noble J. Invest. Dermatol. 1981	vmevada102	IDA	7462664	Structural analysis
Interaction	RegulatedBy Rv3286c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Symbol	crgA	mjackson	IMP		Cell division
Name	Facilitates cell septation	mjackson	IMP		Cell division
Symbol	CrgA	rslayden			homolog of the Streptomyces CrgA protein that is responsible for coordinating growth and cytokinesis in sporogenic aerial hyphae authors,P. Plocinski,M. Ziolkiewicz,M. Kiran,SI. Vadrevu,HB. Nguyen,J. Hugonnet,C. Veckerle,M. Arthur,J. Dziadek,TA. Cross,M. Madiraju,M. Rajagopalan Characterization of CrgA, a new partner of the Mycobacterium tuberculosis peptidoglycan polymerization complexes. J. Bacteriol. 2011
Name	Cell division protein, PG complex	rslayden			homolog of the Streptomyces CrgA protein that is responsible for coordinating growth and cytokinesis in sporogenic aerial hyphae authors,P. Plocinski,M. Ziolkiewicz,M. Kiran,SI. Vadrevu,HB. Nguyen,J. Hugonnet,C. Veckerle,M. Arthur,J. Dziadek,TA. Cross,M. Madiraju,M. Rajagopalan Characterization of CrgA, a new partner of the Mycobacterium tuberculosis peptidoglycan polymerization complexes. J. Bacteriol. 2011
Citation	Characterization of CrgA, a new partner of the Mycobacterium tuberculosis peptidoglycan polymerization complexes. authors,P. Plocinski,M. Ziolkiewicz,M. Kiran,SI. Vadrevu,HB. Nguyen,J. Hugonnet,C. Veckerle,M. Arthur,J. Dziadek,TA. Cross,M. Madiraju,M. Rajagopalan J. Bacteriol. 2011	rslayden		21531798	homolog of the Streptomyces CrgA protein that is responsible for coordinating growth and cytokinesis in sporogenic aerial hyphae

TB Genome Annotation Portal