TB Genome Annotation Portal

Rv0008c (-)

Amino Acid Sequence

MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSARSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSK
HHLWIFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRS
(Nucleotide sequence available on KEGG)

Additional Information

CwsA - cell wall synthesis and cell shape protein A
Plocinski (2012). Mycobacterium tuberculosis CwsA Interacts with CrgA and Wag31, and the CrgA-CwsA Complex Is Involved in Peptidoglycan Synthesis and Cell Shape Determination. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3497543/

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000250;
2 non-insertions in a row out of 4 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 4 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 4 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 4 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000050;
2 non-insertions in a row out of 4 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.67
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.

    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.

    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.

    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv0008c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv0011cvmevada102IDAspectrometric analysis
    authors,L. Walk How long can a gastric erosion persist? Radiologe 1991
    InteractionPhysicalInteraction Rv0011cvmevada102IDAspectrometric analysis
    authors,JL. Norris,NA. Porter,RM. Caprioli Mass spectrometry of intracellular and membrane proteins using cleavable detergents. Anal. Chem. 2003
    InteractionPhysicalInteraction Rv0011cvmevada102IDAStructural analysis
    authors,C. Ryall,G. Holt,WC. Noble Interactions between dermatophyte fungi and staphylococci or Brevibacterium in vitro. J. Invest. Dermatol. 1981
    InteractionPhysicalInteraction Rv0011cvmevada102IDAStructural analysis
    authors,L. Walk How long can a gastric erosion persist? Radiologe 1991
    InteractionPhysicalInteraction Rv0011cvmevada102IDAStructural analysis
    authors,JL. Norris,NA. Porter,RM. Caprioli Mass spectrometry of intracellular and membrane proteins using cleavable detergents. Anal. Chem. 2003
    InteractionPhysicalInteraction Rv0011cvmevada102IDAspectrometric analysis
    authors,K. Moroi,T. Sato Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. Biochem. Pharmacol. 1975
    InteractionPhysicalInteraction Rv0011cvmevada102IDAspectrometric analysis
    authors,C. Ryall,G. Holt,WC. Noble Interactions between dermatophyte fungi and staphylococci or Brevibacterium in vitro. J. Invest. Dermatol. 1981
    InteractionPhysicalInteraction Rv0010cgaat3sNASGene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv0011cgaat3sNASGene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv0011cvmevada102IDAStructural analysis
    authors,K. Moroi,T. Sato Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. Biochem. Pharmacol. 1975

    Comments