Rv0005 (gyrB)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: DNA gyrase subunit B
- REFSEQ: DNA gyrase subunit B
- PATRIC: DNA gyrase subunit B (EC 5.99.1.3)
- TUBERCULIST: DNA gyrase (subunit B) GyrB (DNA topoisomerase (ATP-hydrolysing)) (DNA topoisomerase II) (type II DNA topoisomerase)
- NCBI: DNA gyrase (subunit B) GyrB (DNA topoisomerase (ATP-hydrolysing)) (DNA topoisomerase II) (type II DNA topoisomerase)
- updated information (H37Rv4):
  - gene name: gyrB
  - function:
  - reference:
Type: Not Target
Start: 5240
End: 7267
Operon:

Trans-membrane region:
Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
GO terms:
- GO:0046872 - metal ion binding (Uniprot)
- GO:0046677 - response to antibiotic (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0034335 - DNA supercoiling activity (Uniprot)
- GO:0016853 - isomerase activity (Uniprot)
- GO:0009295 - nucleoid (Uniprot)
- GO:0007059 - chromosome segregation (Uniprot)
- GO:0006265 - DNA topological change (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005694 - chromosome (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
- GO:0005515 - protein binding (Uniprot)
- GO:0003918 - DNA topoisomerase type II (ATP-hydrolyzing) activity (Uniprot)
- GO:0003916 - DNA topoisomerase activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
- GO:0000287 - magnesium ion binding (Uniprot)
- GO:0000166 - nucleotide binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3m4i, 2zjt, 3ig0
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6GAV	100%	Mycobacterium tuberculosis	Extremely 'open' clamp structure of DNA gyrase: role of the Corynebacteriales GyrB specific insert
6GAU	100%	Mycobacterium tuberculosis	Extremely 'open' clamp structure of DNA gyrase: role of the Corynebacteriales GyrB specific insert
5BTN	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of a topoisomerase II complex
5BTL	100%	Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)	Crystal structure of a topoisomerase II complex
5BTI	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of a topoisomerase II complex
5BTG	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of a topoisomerase II complex
5BTF	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of a topoisomerase II complex
5BTD	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of a topoisomerase II complex
5BTC	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of a topoisomerase II complex
5BTA	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of a topoisomerase II complex

Links to additional information on gyrB:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -11.389 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology
- Mycobrowser
- PATRIC

Amino Acid Sequence

VAAQKKKAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVM
TQLHAGGKFDSDAYAISGGLHGVGVSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFL
NKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTAPHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSES
VHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANP
TDAKVVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNT
EVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKK
INKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.997150; 15 non-insertions in a row out of 42 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 40 non-insertions in a row out of 42 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 40 non-insertions in a row out of 42 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 40 non-insertions in a row out of 43 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 41 non-insertions in a row out of 43 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.02
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv0005 (gyrB)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Structural Analysis A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	shahanup86	IDA		Structural Analysis A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Spectrophotometric A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	shahanup86	IDA		Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	shahanup86	IDA		Spectrophotometric A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	shahanup86	IDA		Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Structural Analysis A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	shahanup86	IDA		Structural Analysis A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	vashishtrv	IDA		Spectrophotometric A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	shahanup86	IDA		Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv3361c	shahanup86	IDA		Spectrophotometric A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv3361c	shahanup86	IDA		Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) UH. Manjunatha, S. Mahadevan et al. Monoclonal antibodies to mycobacterial DNA gyrase A inhibit DNA supercoiling activity. Eur. J. Biochem. 2001
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) S. Niemann, D. Harmsen et al. Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. J. Clin. Microbiol. 2000
Citation	Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. X. Yin & Z. Yu The Journal of infection 2010	vmevada102	IPI	20452372	Affinity purification (Physical interaction)
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) X. Yin & Z. Yu Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. The Journal of infection 2010
Citation	Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. A. Aubry, XS. Pan et al. Antimicrob. Agents Chemother. 2004	vmevada102	IPI	15047530	Affinity purification (Physical interaction)
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) A. Aubry, XS. Pan et al. Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. Antimicrob. Agents Chemother. 2004
Citation	Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. Y. Onodera, M. Tanaka et al. J. Antimicrob. Chemother. 2001	vmevada102	IPI	11266418	Affinity purification (Physical interaction)
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Citation	Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Nucleic Acids Res. 2009	vmevada102	IPI	19596812	Affinity purification (Physical interaction)
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. Nucleic Acids Res. 2009
Citation	Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. I. Guillemin, V. Jarlier et al. Antimicrob. Agents Chemother. 1998	vmevada102	IPI	9687411	Affinity purification (Physical interaction)
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Citation	Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. KS. Goh, M. Fabre et al. Mol. Cell. Probes null	vmevada102	IPI	16517119	Affinity purification (Physical interaction)
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) KS. Goh, M. Fabre et al. Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. Mol. Cell. Probes null
Citation	Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. HE. Takiff, L. Salazar et al. Antimicrob. Agents Chemother. 1994	vmevada102	IPI	8031045	Affinity purification (Physical interaction)
Interaction	PhysicalInteraction Rv0006	vmevada102	IPI		Affinity purification (Physical interaction) HE. Takiff, L. Salazar et al. Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. Antimicrob. Agents Chemother. 1994
Citation	Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. S. Niemann, D. Harmsen et al. J. Clin. Microbiol. 2000	vmevada102	IPI	10970363	Affinity purification (Physical interaction)

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Structural Analysis
authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Structural Analysis
A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Spectrophotometric
authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Spectrophotometric
A. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Interaction

Inhibition Rv3361c

vashishtrv

IDA

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

Inhibition Rv3361c

shahanup86

IDA

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
UH. Manjunatha, S. Mahadevan et al. Monoclonal antibodies to mycobacterial DNA gyrase A inhibit DNA supercoiling activity. Eur. J. Biochem. 2001

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
S. Niemann, D. Harmsen et al. Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. J. Clin. Microbiol. 2000

Citation

Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. X. Yin & Z. Yu The Journal of infection 2010

vmevada102

IPI

20452372

Affinity purification (Physical interaction)

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
X. Yin & Z. Yu Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. The Journal of infection 2010

Citation

Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. A. Aubry, XS. Pan et al. Antimicrob. Agents Chemother. 2004

vmevada102

IPI

15047530

Affinity purification (Physical interaction)

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
A. Aubry, XS. Pan et al. Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. Antimicrob. Agents Chemother. 2004

Citation

Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. Y. Onodera, M. Tanaka et al. J. Antimicrob. Chemother. 2001

vmevada102

IPI

11266418

Affinity purification (Physical interaction)

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001

Citation

Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Nucleic Acids Res. 2009

vmevada102

IPI

19596812

Affinity purification (Physical interaction)

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. Nucleic Acids Res. 2009

Citation

Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. I. Guillemin, V. Jarlier et al. Antimicrob. Agents Chemother. 1998

vmevada102

IPI

9687411

Affinity purification (Physical interaction)

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Citation

Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. KS. Goh, M. Fabre et al. Mol. Cell. Probes null

vmevada102

IPI

16517119

Affinity purification (Physical interaction)

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
KS. Goh, M. Fabre et al. Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. Mol. Cell. Probes null

Citation

Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. HE. Takiff, L. Salazar et al. Antimicrob. Agents Chemother. 1994

vmevada102

IPI

8031045

Affinity purification (Physical interaction)

Interaction

PhysicalInteraction Rv0006

vmevada102

IPI

Affinity purification (Physical interaction)
HE. Takiff, L. Salazar et al. Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. Antimicrob. Agents Chemother. 1994

Citation

Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. S. Niemann, D. Harmsen et al. J. Clin. Microbiol. 2000

vmevada102

IPI

10970363

Affinity purification (Physical interaction)

Comments