Rv0005 (gyrB)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: DNA gyrase subunit B
REFSEQ: DNA gyrase subunit B
PATRIC: DNA gyrase subunit B (EC 5.99.1.3)
TUBERCULIST: DNA gyrase (subunit B) GyrB (DNA topoisomerase (ATP-hydrolysing)) (DNA topoisomerase II) (type II DNA topoisomerase)
NCBI: DNA gyrase (subunit B) GyrB (DNA topoisomerase (ATP-hydrolysing)) (DNA topoisomerase II) (type II DNA topoisomerase)
updated information (H37Rv4):
gene name: gyrB
function:
reference:
Coordinates in H37Rv: 5240 - 7267
Gene length: 2028 bp (with stop codon), 675 aa (without stop codon)
Operon:
Trans-membrane region:
Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3m4i , 2zjt , 3ig0
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 9FOY 100% Mycobacterium tuberculosis H37Rv Ternary complex of a Mycobacterium tuberculosis DNA gyrase core fusion with DNA and the inhibitor AMK32b 8S7O 100% Mycobacterium tuberculosis M. tuberculosis gyrase holocomplex with 150 bp DNA and BDM71403 8S7K 100% Mycobacterium tuberculosis M. tuberculosis gyrase holocomplex with 150 bp DNA and gepotidacin 7UGW 100% Mycobacterium tuberculosis H37Rv M. tuberculosis DNA gyrase cleavage core bound to DNA and evybactin 6GAV 100% Mycobacterium tuberculosis Extremely 'open' clamp structure of DNA gyrase: role of the Corynebacteriales GyrB specific insert 6GAU 100% Mycobacterium tuberculosis Extremely 'open' clamp structure of DNA gyrase: role of the Corynebacteriales GyrB specific insert 5BTN 100% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of a topoisomerase II complex 5BTL 100% Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Crystal structure of a topoisomerase II complex 5BTI 100% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of a topoisomerase II complex 5BTG 100% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of a topoisomerase II complex
Links to additional information on gyrB:
Amino Acid Sequence
VAAQKKKAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVM
TQLHAGGKFDSDAYAISGGLHGVGVSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFL
NKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTAPHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSES
VHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANP
TDAKVVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNT
EVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKK
INKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0005/gyrB,
gene len: 2027 bp, num TA sites: 40
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath uncertain M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-1.37) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.0) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.0) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0005: 0.8160685
lineage-specific pN/pS in L1: 0.301467407
lineage-specific pN/pS in L2: 2.731800885
lineage-specific pN/pS in L3: 0.751044429
lineage-specific pN/pS in L4: 0.825682577
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? YES
omega peak height (95%CI lower bound) 3.04 (1.19)
codons under selection 499, 500, 501, 502
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction Inhibition Rv3361c vashishtrv IDA Structural Analysisauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction Inhibition Rv3361c vashishtrv IDA Structural AnalysisA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c shahanup86 IDA Structural AnalysisA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c vashishtrv IDA Spectrophotometricauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction Inhibition Rv3361c vashishtrv IDA SpectrophotometricA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c shahanup86 IDA Spectrophotometricauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction Inhibition Rv3361c shahanup86 IDA SpectrophotometricA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c shahanup86 IDA Structural Analysisauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction Inhibition Rv3361c vashishtrv IDA Structural Analysisauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction Inhibition Rv3361c vashishtrv IDA Structural AnalysisA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c shahanup86 IDA Structural AnalysisA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c vashishtrv IDA Spectrophotometricauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction Inhibition Rv3361c vashishtrv IDA SpectrophotometricA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c shahanup86 IDA Spectrophotometricauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction Inhibition Rv3361c shahanup86 IDA SpectrophotometricA. Mrens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction Inhibition Rv3361c shahanup86 IDA Structural Analysisauthors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)UH. Manjunatha, S. Mahadevan et al. Monoclonal antibodies to mycobacterial DNA gyrase A inhibit DNA supercoiling activity. Eur. J. Biochem. 2001
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)S. Niemann, D. Harmsen et al. Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. J. Clin. Microbiol. 2000
Citation Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. X. Yin & Z. Yu The Journal of infection 2010 vmevada102 IPI 20452372 Affinity purification (Physical interaction)
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)X. Yin & Z. Yu Mutation Characterization of gyrA and gyrB Genes in Levofloxacin-resistant Mycobacterium tuberculosis Clinical Isolates from Guangdong Province in China. The Journal of infection 2010
Citation Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. A. Aubry, XS. Pan et al. Antimicrob. Agents Chemother. 2004 vmevada102 IPI 15047530 Affinity purification (Physical interaction)
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)A. Aubry, XS. Pan et al. Mycobacterium tuberculosis DNA gyrase: interaction with quinolones and correlation with antimycobacterial drug activity. Antimicrob. Agents Chemother. 2004
Citation Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. Y. Onodera, M. Tanaka et al. J. Antimicrob. Chemother. 2001 vmevada102 IPI 11266418 Affinity purification (Physical interaction)
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)Y. Onodera, M. Tanaka et al. Inhibitory activity of quinolones against DNA gyrase of Mycobacterium tuberculosis. J. Antimicrob. Chemother. 2001
Citation Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Nucleic Acids Res. 2009 vmevada102 IPI 19596812 Affinity purification (Physical interaction)
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)authors,G. Fu,J. Wu,W. Liu,D. Zhu,Y. Hu,J. Deng,XE. Zhang,L. Bi,DC. Wang Crystal structure of DNA gyrase B' domain sheds lights on the mechanism for T-segment navigation. Nucleic Acids Res. 2009
Citation Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. I. Guillemin, V. Jarlier et al. Antimicrob. Agents Chemother. 1998 vmevada102 IPI 9687411 Affinity purification (Physical interaction)
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)I. Guillemin, V. Jarlier et al. Correlation between quinolone susceptibility patterns and sequences in the A and B subunits of DNA gyrase in mycobacteria. Antimicrob. Agents Chemother. 1998
Citation Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. KS. Goh, M. Fabre et al. Mol. Cell. Probes null vmevada102 IPI 16517119 Affinity purification (Physical interaction)
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)KS. Goh, M. Fabre et al. Study of the gyrB gene polymorphism as a tool to differentiate among Mycobacterium tuberculosis complex subspecies further underlines the older evolutionary age of 'Mycobacterium canettii'. Mol. Cell. Probes null
Citation Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. HE. Takiff, L. Salazar et al. Antimicrob. Agents Chemother. 1994 vmevada102 IPI 8031045 Affinity purification (Physical interaction)
Interaction PhysicalInteraction Rv0006 vmevada102 IPI Affinity purification (Physical interaction)HE. Takiff, L. Salazar et al. Cloning and nucleotide sequence of Mycobacterium tuberculosis gyrA and gyrB genes and detection of quinolone resistance mutations. Antimicrob. Agents Chemother. 1994
Citation Differentiation of clinical Mycobacterium tuberculosis complex isolates by gyrB DNA sequence polymorphism analysis. S. Niemann, D. Harmsen et al. J. Clin. Microbiol. 2000 vmevada102 IPI 10970363 Affinity purification (Physical interaction)